Obchodné meno registratora EXO TECHNOLOGIES spol. s r.o.
Identifikator registratora EXOT-0004
Adresa Garbiarska 3, Stará Ľubovňa
Telefón +421221028430
E-mail support zavináč exohosting bodka sk
pozicovnanitra.sk- EXO HOSTING - webhosting, domény
pozicovnavysavacov.skLenmar Solution | Hygienické riešenia podľa Vašich predstáv
pozlatenepiny.skHome pozlatenepiny.sk - Výkup pozlatene piny,konektory,baterie ..
pozorradar.skMobilná aplikácia do auta - Pozor RADAR
pp-tech.sk
ppapiernictvo.sk- EXO HOSTING - webhosting, domény
ppartl.skÚvod
ppf.sk
ppfolia.skppfolia.sk
ppmgroup.sk
ppop.skComing Soon
pppoprad.skPriemyselný park Poprad
ppproduction.skSvadba PP Production - svadba podľa vašich snov.
pprc.skPP Rent Car, s.r.o.
ppsafety.skOsobné ochranné pracovné pomôcky - Ing. Jozef Podolec - PP SAFETY
ppslovakia.skPodlahy, Tapety, Príslušenstvo - PAR-KY, QUICK STEP | P&P Slovakia
ppsone.skChránená dielňa PPS One | Chránené pracovisko
ppsse.sk- EXO HOSTING - webhosting, domény
ppssk.sk
pptaxi.skPP Taxi Zvolen
ppv.sk
pr-invest.sk- EXO HOSTING - webhosting, domény
praca-doma.sk- EXO HOSTING - webhosting, domény
praca-kariera.skPraca-kariera.sk | ponuka a inzercia práce | profesia
praca-ponuka.skPráca-Ponuka | Pracovný portál
pracaakozmetika.skPráca s kozmetikou a líčenie
pracabezhranic.skPráca vo Švajčiarsku. Práca pre remeselníkov vo Švajčiarsku. Práca na farmách vo Švajčiarsku. Agentúra PracaBezHranic.sk
pracacezinternet.skNová práca z domu aj cez internet.Skvelá pracovná príležitosť
pracaeuropa.skpracaeuropa.sk
pracaopatrovatelky.sk
pracapoprad.skPonuka práce | Vitajte na www.pracapoprad.sk
pracavnemecku.sk
pracavonku.skPraca v zahraničí
pracavpriemysle.sk
pracawellness.skPraca Wellness
pracky-servis.skServis pračiek a umývačiek riadu - Predaj, dovoz a inštalácia pračiek aj zabudovaných spotrebičov - Miroslav Gavorník
prackyopravy.skMarián Bartoš - Smižany
pracodevy.skPracovné oblečenie
pracovna-eka.sk
pracovnadoska.skPracovné dosky CORIAN
pracovneodevy-monterky.skPracovné odevy, montérky výroba a predaj Nitra
pracovneodevyaobuv.skPracovné odevy, pracovná obuv - Pracant.eu
pracovnestanice.skPracovné stanice
pracovnykompas.sk- EXO HOSTING - webhosting, domény
pradlenka.skweb
praetoria.skPraetoria s.r.o. - Internetový obchod s náradím Dedra - Praetoria internetovy obchod
pragmatickaunia.sk
prakovcata.sk.:: www.prakovcata.sk ::.
pramaclean.skPRAMA CLEAN s.r.o.
prasiatko.sk
praskovefarbenie.skABC DESIGN - praskove farbenie
pravasolnajaskyna.skPravá Soľná Jaskyňa | Vytvorenie a budovanie nových soľných jaskýň na Slovensku aj v zahraničí.
pravdaodiamantoch.sk- EXO HOSTING - webhosting, domény
praveorechove.sklubo michalko
pravneforum.skPrávne Fórum :: Online právna poradňa zdarma
pravnickeskolenia.sk- EXO HOSTING - webhosting, domény
pravnyasistent.skLegalasist.sk
pravonazivot.sk
pravyhodvab.sk- EXO HOSTING - webhosting, domény
praznakova.skKvalita odlišuje,Prazňáková preklady
pre.sk- EXO HOSTING - webhosting, domény
precoplatit.skPrevencia vzniku pohľadávok | Prečo platiť
precopraveja.sk
predaj-bicyklov.sk
predaj-cez-internet.skPredaj cez internet / Ako predávať cez internet
predaj-med.skPredaj medu Včielka Helenka
predaj-online.sk
predaj-pc.skE-SHOP, NOTEBOOKY, POČÍTAČE, SATELITY, ELEKTRO, SERVIS, REGISTRÁCIA A HOSTING DOMÉN, TVORBA WWW STRÁNOK, PROGRAMOV a APLIKÁCII
predajcddvd.skPredaj CD a DVD médií - PredajCDDVD.sk
predajdreva.skPREDAJ DREVA
predajhodiniek.skPREDAJHODINIEK.SK
predajizolacie.skPredaj izolácie
predajkotlov.skPredaj a servis kotlov
predajkoze.skPelzleder
predajkrbov.skKachle, pece, krby, komíny Spišská Nová Ves
predajmobil.skPredajmobil.sk - Inzeráty zadarmo a bez registrácie na www.predajmobil.sk
predajnamas.skPredajna MaS
predajnanabytku.skPredajnanabytku.sk - Nabytkarstvo.sk
predajnovostavieb.sk- EXO HOSTING - webhosting, domény
predajonline.sk
predajpc.sk
predajplotov.skLESA | ploty, poplastované ploty a brány
predajpohladavok.sk- EXO HOSTING - webhosting, domény
predajsro.sk
predajvin.skEBBL, s.r.o. - Darčekové vína, Mydlá, Ajvary
predam-alternator.skPredaj alternátorov
predam-byt.skPredám 3 izbový byt v Senci
predam-garaz.sk- EXO HOSTING - webhosting, domény
predam-motor.skPredaj motorov
predam-starter.skPredaj štartérov
predamgaraz.sk- EXO HOSTING - webhosting, domény
predas.skPredas.sk - Predas.sk Inzerujte svoju ponuku zadarmo a bez registrácie jednoduchým spôsobom zadávania
predent.sk
predloha.skÚVOD - Predloha
predops.skPreDops s.r.o. - výroba dosiek plošných spojov
predovka.sk- EXO HOSTING - webhosting, domény
predovky.sk- EXO HOSTING - webhosting, domény
predskolacik.skSúkromná škôlka Bratislava - DC PREDŠKOLÁČIK
predstav.sk:: www.predstavsa.sk
predstavsa.sk:: www.predstavsa.sk
predvolby.skTelefonne Predvolby
prefinancovanieuveru.skPrefinancovanie úveru, refinancovanie hypotéky
prehoz.skPREHOZ
prehozy-navliecky.sk   PREHOZY
preisler.skVizitka
preklad-anglictina.sk- EXO HOSTING - webhosting, domény
preklad-anglictiny.skPreklad angličtiny, Preklad zo slovenčiny do angličtiny
preklad-nemcina.skJana Valková - Nemčina - Odborný a úradný preklad
preklad-nemciny-slovenciny.skPreklad z nemčiny do slovenčiny, Preklad do nemčiny
preklad-nemciny.skPreklad nemčiny, Preklad zo slovenčiny do nemčiny
preklad-textov.skPreklad textov, Preklad
prekladac-viet.skPrekladač viet - preklad viet a preklad textov
prekladatelia-tlmocnici.skUž čoskoro
prekladatelska.skRegister prekladateľov SR
prekladstranok.sk
prekladtextu.skPreklad textu, Preklad
preklady-ticha.skÚradný preklad - www.preklady-ticha.sk
preklady-velkymeder.skÚvod
prekladystranok.skPreklad web stránok, textov a dokumentov
prekladywrede.skÚradné preklady nemčina
prekrasu.sk- EXO HOSTING - webhosting, domény
prelepsivranov.skPre Lepsi Vranov
preliezka.skDomov | Preliezky Trubíni
prelov.sk
premamu.skOnline obchod - Premamu.sk
premamy.skVšetko pre mamy - Obchod pre v
premesto.skAktualisiere deinen Browser | Facebook
premier-first.skHauptseite
premiera.sk
premietanie.skPREMIETANIE.SK
premiokosice.skMilujete Vaše auto? My tiež! • A STEEL s.r.o.
premiumproperty.skPremiumWeb
premiumweb.skPREMUIMWEB.sk
premobil.skPremobil.sk
premost.skDrevné okná | Drevené dvere | PREMOST.sk
premoto.sk
prems.skwww.prems.sk
prenajmito.sk
prenajom-leseni.sk- EXO HOSTING - webhosting, domény
prenajom-lodi.skPrenájom lodi
prenajom-rybany.skPrenájom priestorov v obci Rybany - Úvod
prenajom123.skPrenájom projektoru a projekčného plátna Prenajom123.sk
prenajombytu.sk- EXO HOSTING - webhosting, domény
prenajomdebnenia.sk- EXO HOSTING - webhosting, domény
prenajomdjtechniky.skOZVUČENIE a OSVETLENIE | SOUND and LIGHT, s.r.o..
prenajomdodavok.skPrenájom dodávok Poprad - Prenájom dodávok Poprad
prenajomkaraoke.skKaraoke Star: …spievanie, mám zo všetkého najradšej…
prenajomkaravanov.skPrenájom Karavanov a Autokaravanov
prenajomleseni.skStaves plus - Prenájom montáž lešenia Košice Cena - Lešenie Cenník lešení Prešov, Poprad
prenajomnovezamky.skPrenájom Nové Zámky - Byty na prenájom, predaj bytov a nehnuteľností, Nové Zámky
prenajomosvetlenia.skOZVUČENIE a OSVETLENIE | SOUND and LIGHT, s.r.o..
prenajomsidla.skProfuturion
prenajomskutrovkosice.skskútre - prenájom skútrov Košice function clearText(field) { if (field.defaultValue == field.value) field.value = ''; else if (field.value == '') field.value = field.defaultValue; }
prenajomstoliciek.sk- EXO HOSTING - webhosting, domény
prenajomstvorkoliek.skPrenájom štvorkoliek
prenajomtechniky.skOZVUČENIE a OSVETLENIE | SOUND and LIGHT, s.r.o..
prenajomvozidiel-nitra.skPrenájom vozidiel-Nitra.sk AUTOPOŽIČOVŇA
prenoma.skprenoma / Prenoma, s.r.o.
prepelicky.sk- EXO HOSTING - webhosting, domény
prepona.skPREPONA - Predajňa a požičovňa náradia
prepozitura.skPrepozitúra Panny Márie - Úvodná stránka
preprava-varsa.skOnrej Varša - rýchlo - bezpečne - komfortne a bez prestupovania
prepravaopatrovateliek.sk- EXO HOSTING - webhosting, domény
presentas.skReklama, darčeky, polepy, banery, reklamný textil, diáre | Presentas.sk
presny.skPRESNY | Profesionálne služby pre bývanie
presov-byty.sk- EXO HOSTING - webhosting, domény
presov-poistenie.skRealitná kancelária Allfin Real, s.r.o. - Úvod
presovskydixieland.skPrešovský dixieland
presovskypivovar.skPrešovský pivovar
presporskamedovina.skPrešporská medovina | Tradičná prírodná medovina
presporskapivoteka.skSvet rozmanitých chutí piva Prešporská pivotéka
pressburgrass.sk
prestapro.sk
prestieradla-plachty.skPrestieradlá – Plachty
prestige-photo.skPrestige photo
prestige-shop.sk
prestigeclub.skPrestige
prestigephoto.skPrestige photo
prestimex.skPRESTIMEX s.ro.
prestudenta.skAktualisiere deinen Browser | Facebook
pretekyavysledky.skPreteky a výsledky | Responsive WordPress Gym Fitness Theme
pretlaky-pezinok.skPODVŔTANIE A PRETLÁČANIE CIEST - VLADIMÍR CHOVANEC
pretty-body.skGuess | Pretty & Body
pretty-trading.skIntro PRETTY Trading
preukazy.sk
preurady.skPripravujeme // Coming Soon
prevozne-znacky.sk
prezents.skPrezents-reklamná agentúra Pri objednávke nad 45 € doprava zdarma !
prezmont.skPREZMONT
prezuj.skVitajte | Prezuj.sk - Pneumatiky, hliníkové disky, plechové disky, kolesá
prezutauto.skPneuservia a predaj pneumatík v Bratislave
prezuvanie-pneumatik.sk
prezvolen.skNezávislá iniciatíva pre Zvolen - úvodná stránka
priamypredaj.sk- EXO HOSTING - webhosting, domény
priamypredajyvesrocher.sk- EXO HOSTING - webhosting, domény
pribinacek.skPribináček.sk
prices.sk- EXO HOSTING - webhosting, domény
pricesky.skwww.pricesky.sk
pridajte.sk- EXO HOSTING - webhosting, domény
pridanahodnota.sk- EXO HOSTING - webhosting, domény
prielozny.skZáhradníctvo Prieložný
priemyselnachemia.skElektro náradie a pracovná technika pre závody, firmy, kutilov aj domácich majstrov - DUVALO.sk
priemyselnecerpadla.sk- EXO HOSTING - webhosting, domény
priemyselnepodlahy.sk
priemyselnyvysavac.skpriemyselný vysávač
priesaky.skPriesaky a zatekanie do budov
prieskumnamieru.skPrieskum Na Mieru –
prihlasenievozidla.skwww.prihlasenievozidla.sk » Vaše auto naše starosti
primacop.skPrimacop
primalingua.sk
primapodhajska.skPenzión Prima Podhájska - rekreácia, ubytovanie, stravovanie, oddych, firemné podujatia, kongresy, školenia
primareality.skPRIMA realitná a právna kancelária
primarico.sk
primataxi.skPrimaTaxi - Vaša taxislužba | Kontakt
primatoronline.skprimátor Ján Volný online
primaubytovanie.sk- EXO HOSTING - webhosting, domény
princeps.sk
principium.skPrincipium - školenia, semináre, pracovné príležitosti
print123.skVeľkoformátová/veľkoplošná tlač - BIG PRINT
printcloud.sk- EXO HOSTING - webhosting, domény
printe.skTonery a náplne do tlačiarní
printerio.skPrinterio - veľkoobchod náplne do tlačiarní, tonery, cartridge
printimages.skPrintImages.sk
printmedia.skPrintmedia
printon.skPrinton s.r.o. - Titulná stránka
printonline.sk- EXO HOSTING - webhosting, domény
printplace.sk
pripravanaporod.skMaterstvo.sk
prirodalieci.skHLAVNÁ STRÁNKA
prirodanasbavi.skPríroda nás baví - Úvodná strana
prirodnaliecba.skPrírodná liečba
prirodneobklady.skPrirodne Obklady
prirodneomietky.sk
prisaha.sk
prisma.sk
prisonpizza.skPrison Pizza
pristavkysuce.sk
pristrojela.skThe Tudors
privat-gerlachov.skPrivát Gerlachov
privat-hacava.skPrivát Hačava - ubytovanie v srdci prírody
privat384.sk..:: Privát 384 - penzión, ubytovanie, Spišský Štiavnik ::..
privatanna.sk-= Privat Anna - ubytovanie -Terchová, Malá Fatra, Vrátna =-
privatdebt.skPRIVATdebt - expert na vymáhanie pohľadávok
privatepage.sk
privateweb.skRedirected
privatflanderova.skPrivát - Valéria Flanderová
privatkamilka.skPrivat Kamilka
privatkatrina.skPrivatKatrina.sk - Privat Katrina Liptovský Trnovec - ubytovanie na Liptove
privatliptov.sk- EXO HOSTING - webhosting, domény
privatlubica.skPrivát Ľubica - ubytovanie, Liptov, Vysoké Tatry
privatmartina.skPrivát Martina | Ubytovanie pri Slovenskom raji
privatninaliptov.sk- EXO HOSTING - webhosting, domény
privatprima.skAk na pobyt, tak jedine k nám :)
privatseverka.sk- EXO HOSTING - webhosting, domény
privatsherpa.skPrivat Sherpa | Ubytovanie v Tatrach za rozumnu cenu.
privatsiesta.skPrivát Siesta
privatsvist.skVila Svišť
privatumervarta.skUbytovanie Privát U Mervarta - Mengusovce Vysoké Tatry - cenovo prístupné ubytovanie
priya.skÚvod
prizma.skKonferencia PRIZMA
pro-body.skŠPORTTESTERY POLAR, CYKLOTRENAŽÉRY, DOPLNKY PRE ŠPORTOVCOV | pro-body.sk
pro-data.skDomov
pro-eco.sk
pro-eko.sk
pro-fundus.sk- EXO HOSTING - webhosting, domény
pro-life.sk- EXO HOSTING - webhosting, domény
pro-mobil.skpro mobil
pro-mont.skJOZEF KRAJČÍR - PROMONT
pro-servis.skHome
proactive-english.skHome
proamericana.skPro Americana - Jazyková škola. Anglický jazyk pre materské
probar.skBarové potreby - ProBarShop.sk
probecop.skPROBECOP
proben.skProBen - ortopedicko-protetické pomôcky
probet.skproBET.sk | Tipovanie, tipy, analýzy, správy, výsledky, štatistiky, diskusia
problem.sk- EXO HOSTING - webhosting, domény
probunka.sk- EXO HOSTING - webhosting, domény
procad.sk
processcontrol.skProcess Control s.r.o.
prochazkovci.skProcházkovci
prochrist.skÚvod
procka.skLife is what you make out of it
procom.skProCom, spol. s r.o.
procontrol.skRev
procurement.skITAPS s. r. o.
proding.skProding s.r.o. Banska Bystrica
prodlazba.skProdlažba - Vymývaná dlažba z dunajského štrku
prodomont.skProdomont
productdesign.skNerezové lavičky
productfeed.sk Podporujeme zdravie u zvierat! |
produktovyweb.sk- EXO HOSTING - webhosting, domény
proecon.sk- EXO HOSTING - webhosting, domény
proelite.skCARvalet - chémia a kozmetika pre automobily
proenergo.sk- EXO HOSTING - webhosting, domény
proentech.skProentech Hlavicka PROJEKTOVÁ KANCELÁRIA EKOLOGICKÉ, ENERGETICKÉ A TECHNOLOGICKÉ PROJEKTY Navigacia
proexport.skproexport.sk AUTIPOŽIČOVŇA, AUTOSERVIS, LUXUSNÉ ŠATY
profesionalita.skTitle Here
profesionalna-kozmetika.sk- EXO HOSTING - webhosting, domény
profesionalnakozmetika.sk- EXO HOSTING - webhosting, domény
profesionalnetipy.sk
profesionalny-koucing.sk- EXO HOSTING - webhosting, domény
profesionalnykoucing.sk- EXO HOSTING - webhosting, domény
profesionalnyvysavac.skProfesionálny vysávač
professencounter.sk
professionalenglish.skE-SHOP, NOTEBOOKY, POČÍTAČE, SATELITY, ELEKTRO, SERVIS, REGISTRÁCIA A HOSTING DOMÉN, TVORBA WWW STRÁNOK, PROGRAMOV a APLIKÁCII
profi-autoservis.skPROFI-AUTOSERVIS, s.r.o. Lokca, kvalitný a dostupný servis pre Vaše auto
profi-chiptuning.skNovinky | MM RACING - chiptuning
profi-farby.skProfi FARBY | pre to pravé použitie
profi-hair.skProfi Hair
profi-krtko.sk..:: PROFI KRTKO ::.. PREPCHÁ A PREČISTÍ VAŠU KANALIZÁCIU
profi-naplne.sk- EXO HOSTING - webhosting, domény
profi-obkladac.skObkladanie | profi-obkladac.sk
profi-team.skÚvod - Profi-Team s.r.o. obkladačské práce
profi-toner.sk- EXO HOSTING - webhosting, domény
profi-tuning.skChip tuning, auto diagnostika | mmracing.sk Bratislava
profiautokozmetika.skStar Brite - Profesionálna autokozmetika
proficon.skProFiCon, s.r.o. - Profil
profidach.sk- EXO HOSTING - webhosting, domény
profidesign.skReklamná agentúra PROFI design, s.r.o., Dolný Kubín - komplexné reklamné služby
profighters.skProFighters všetko pre bojové športy
profigrafi.skprofigrafi.sk
profiheat.skhttp://www.profiheat.sk/ Úvod
profihypoteka.sk
profikovo.skDomov
profiland.sk- EXO HOSTING - webhosting, domény
profiledky.sk- EXO HOSTING - webhosting, domény
profilinvest.skProfil Invest Slovakia s.r.o. - Plastové, hliníkové okná a dvere
profilter.skProfilter - priemyselná filtrácia vody
profima.skP R O F I M A - Náradie profesionálov
profimasaze.skProfi Masáže - Štúdio Krásy - Darina Malá, tel. 0905-943-563, Trnava
profimaska.skNHT Global - Tvoríme tradíciu wellness
profimetal.skProfimetal
profimont.skO firme
profimotor.skOprava motorov a ich súčastí | Profimotor
profin.skProfin.sk - Pois
profinac.sk- EXO HOSTING - webhosting, domény
profinex.skProfinex - Kuchynské štúdio, kuchynské linky na mieru, interiérový dizajn, podlahy, nábytok
profioblecenie.sk- EXO HOSTING - webhosting, domény
profipanel.skProfiPanel s.r.o
profiplus.sk
profipojex.sk- EXO HOSTING - webhosting, domény
profipreklady.sk
profiprojex.skprofiprojex: projektovanie stavieb
profirealsk.skPROFIREALSK
profisanita.sk
profistore.skProfiStore - elektronika, elektrotechnika
profistroje.sk
profit-nabytok.skProfit Nábytok - Čalúnený nábytok - Výroba a predaj čalúneného nábytku
profitconsult.sk
profitest.skPROFITEST || Inžinierska činnosť pre vyhradené technické zariadenia
profitmark.skDOMO
profitparketbytca.skTvorba web stránok | EDMAX, s.r.o.
profitrening.sk
profiuctovnicka.skCAS s.r.o.
profivysavace.skProfi vysávače
profizahradkar.skProfi ZÁHRADKÁR
profor.skwww.profor.sk
profuturion.sk
profylaktika.skČistenie a servis počítačov • Profylaktika
progames.sk
progeos.skprogeos
progit.skProgIT
program.skTV program na Program.sk
programtv.skTV program na Program.sk
programvmeste.sk
progresmt.skPROGRES MT | ... nerobíme JEDNU VEC O 100% lepšie ako iní, ale robíme 100 VECÍ O 1 % lepšie ako iní ...
progrespersonal.skProgres Personal Leasing
progressiveoptik.skwww.progressiveoptik.sk
progresstechnologies.skSpráva budov, bytov a nebytových priestorov. Upratovacie služby
progrestherm.skPROGRES THERM s.r.o. | Všetko ohľadom vody, kúrenia, plynu a kanalizácie
prohaxx.sk
prohodinky.sk- EXO HOSTING - webhosting, domény
proint.sk
prointeligence.skProintelligence
prointelligence.skProintelligence
prointerpreter.skPro Interpreter - simultánne, konferenčné a konzekutívne tlmočenie, tlmočník a prekladateľ, preklady jazykov angličtina, francúzština, Bratislava, Trnava
project-lehnice.skPOJECT-LEHNICE - Home
projectinterier.sk
projectpb.skUntitled Document
projectum.sk- EXO HOSTING - webhosting, domény
projectx.skProject X - MOTEL KAMENEC - 15.8.2014
projekciasvrcek.skÚvod | P.S - projekt
projekt-dom.sk
projekt-domu.skProjekty domov - Rodinné domy VITADOM
projekt-ing.sk
projektkardiak.sk
projektmetro.sk
projektorarchitekti.skprojekt:or
projektxcape.sk- EXO HOSTING - webhosting, domény
projektybsk.sk
projektybudov.skProjekcia statiky stavieb
projektypredeti.skProjekty pre deti - Úvod
projektystavieb.skINPRO spol. s r.o. Prievidza - projekty stavieb, projektovanie
projektyzateplenia.skProjekty zateplenia - Vaše bývanie krajšie a úspornejšie
projektzrkadlo.sk
prokancel.sk- EXO HOSTING - webhosting, domény
proksova.skGabriela Proksova
prokyon.skPROKYON - Výroba reklamy - O firme
prolad.skProLad s.r.o. | projekčná a architektonická kancelária Martin, Žilina, Dolný Kubín
prolegis.sk- EXO HOSTING - webhosting, domény
prolink.skPROLINK - P R I N T H I N G S
prolustop.skProlustop
prom-medic.sk
promark.sk- EXO HOSTING - webhosting, domény
promatic.sk- EXO HOSTING - webhosting, domény
promifashion.skDomov - Promi Fashion.sk
promo1.skPromo1
promodel.skProModel - modelovanie, architektonické modely, modely, miniatúry, scale, mierka, plasty, CNC fréza, metal etching, leptanie
promodesign.skPROMO DESIGN s.r.o., reklamná firma
promonotes.skwww.promonotes.sk | KATALÓG REKLAMNÝCH PREDMETOV | VÝROBA
promont.skPromont spol. s r.o. Prešov - voda - plyn - kúrenie - projekcia - montáž - servis - technológie vykurovania
promontasro.sk- EXO HOSTING - webhosting, domény
promontca.skPromont - zasklievanie balkónov a terás, výroba vitráží a dekoračného skla - O nás
promosys.skPromosys
promotex.sk
promotionmedia-autofolie.skAUTOFÓLIE - PROMOTION MEDIA, s.r.o. - Považská Bystrica, Púchov, Bytča, Žilina, Ilava, Trenčín, Dubnica nad Váhom - autofólie HP PROSOLAR, dodávka a montáž autofólií
promotionmedia.skAUTOFÓLIE - PROMOTION MEDIA, s.r.o. - Považská Bystrica, Púchov, Bytča, Žilina, Ilava, Trenčín, Dubnica nad Váhom - autofólie HP PROSOLAR, dodávka a montáž autofólií
promoto.skPromoto - promoto.sk - moto príslušenstvo
proorder.skProOrder - system for making orders and bookings
properservis.skProper Servis - cleaning & garden services
propharma.sk
prophotostudio.skProphotostudio s.r.o.
propodlahy.skProPodlahy - Brúsenie, Renovácie, Terasy, Podlahy Poprad
propopulo.skWelcome to the Frontpage
proposal.sk- EXO HOSTING - webhosting, domény
proproduction.skPRO//PRODUCTION sound & light | ozvučenie, osvetlenie, videoprojekcie, led steny
prorate.sk
prorax.sk- EXO HOSTING - webhosting, domény
proreality.skProReality - realitná kancelária
prosecco-vino.skHistória - Prosecco-vino.sk
prosit.sk- EXO HOSTING - webhosting, domény
prosort.sk- EXO HOSTING - webhosting, domény
prospark.sk- www.exohosting.sk - Vás profi webhosting
prosportshop.sk
prostroj.skÚVOD - Prostroj s.r.o.| Výroba náhradných dielov a pneumatických sejacích strojov
protectionband.skAktualisiere deinen Browser | Facebook
protego.skSEO Optimalizácia - Protego
protein-bielkoviny.skPROTEIN | ESHOP – Proteiny pre športovcov –
protein-info.sk
protein-kreatin.skProtein Kreatin | Protein a kreatín – najdôležitejšie suplementy pre športovcov
proteingainer.skwww.svetsvalov.sk | Internetový obchod s doplnkami výživy za najnižšie ceny v SR
protelcont.skProtelcont s. r. o. - Meranie a regulácia, riadenie technologických procesov, diaľkový prenos dát, dispečingy
protiakne.sk- EXO HOSTING - webhosting, domény
protikomarom.sk- EXO HOSTING - webhosting, domény
protismer.sk
protourion.skInkaso a vymáhanie pohľadávok
provance.skNábytok Provance
provans.skProvans Design | zmeňte svoje bývanie na vysnívaný domov
provencevm.skProvence apartmany
provideo.sk
provitalis.skProVitalis - Súkromné centrum prevencie a regenerácie
prowil.skPROWIL.sk - obklady, dlažby
proximus.sk- EXO HOSTING - webhosting, domény
proxone.sk- EXO HOSTING - webhosting, domény
prr.skPRR Reality - Najnovšie ponuky
prsiasudar.skPrsia sú dar - Mamografické a ultrazvukové vyšetrenia
prst.skpomoc,ochrana, zabezpečenie, minikamery, odposluch - PRST SK - Ochrana, zabezpečenie a minikamery
prsteneonline.sk- EXO HOSTING - webhosting, domény
prtrade.skZákladná stránka webhostingu | Websupport.sk
prud.skPrud.sk
prudknihy.skPrud.sk
prvanzstk.skPrvá Novozámocká STK | Technické kontroly, Emisné kontroly, Kontroly originality
prvapomockurz.skLSE – Life Star Emergency – kurzy inštruktorov a záchranárov | Kurz prvej pomoci
prvaslnecna.sk- EXO HOSTING - webhosting, domény
prvazbrojarska.skUntitled
prve.sk
prvelastovicky.skObčianske združenie Prvé lastovičky - Hlavná stránka
prvymanzelskyservis.sk
prvypravnydom.skPrvý právny dom - Kuzmányho 4, Martin
pryzmat.skMapa sklepów - Pryzmat
psc-impulz.skPracovno-socializačné centrum Impulz | Chceme žiť s Vami, nie vedľa Vás.
psenka.sk
psera.skERA – Kompletné pohrebné služby – PreÅ¡ov, Sabinov NONSTOP 0918 560 422
psiakozmetika.skPsia Kozmetika
psiedobroty.skPsie Dobroty
psiemnamky.sk- EXO HOSTING - webhosting, domény
psieoblecenie.skNika Dog Fashion - Oblečenie pre psíkov
psioph.skPSIOPH
psipark.skPsí Park | Voľný pohyb, výcvik, šport, zábava
psiraj.skhotel pre psy | Vitajte v hoteli pre psov Psí raj, psia škôlka Bratislava, psia škôlka v Bratislave, hotel pre psov v Bratislave
psiuces.skPsí účes
psiutulok.skÚtulok - o nás
psk.sk- EXO HOSTING - webhosting, domény
psnr.skPozemkové spoločenstvo Nižné Ružbachy - O NÁS
psprofile.sk- EXO HOSTING - webhosting, domény
psreality.skMagazín o realitách a stavebníctve pre Bratislavu a okolie | PS reality
pssolution.skPS Solution – tie správne riešenia – O nás
psstavb.skzateplovanie
pstros.sk- EXO HOSTING - webhosting, domény
psyche-medica.sk
psychiater-sexuolog.skJUDr. MUDr. Ján UHRIN
psychiater-znalec.skJUDr. MUDr. Ján UHRIN
psychiatria-znalec.sk
psycho-terapia.skwww.psycho-terapia.sk - úvod do ponuky psychoterapie a poradenstva
psycholog-bratislava.sk- EXO HOSTING - webhosting, domény
psychologia-kosice.sk
psychologiakosice.skPhDr. Katarína Kubašovská - www.psychologiakosice.sk
psychologicka-poradna.skPsychologická poradňa, psychológ - Žilina - Richard Gróf, PhD.
psychologvychod.skPsychológ Východ
psychoporadna.skAnonymna psychologicka poradna - poradenstvo s psychologom cez e-mail, osobne konzultacie, diskusne forum
psychoservis.skPhDr. Alexandra Putzová - psychológ Bratislava
psychotherapy.sk
ptauto.skPTAUTO Autoservis Košice
ptdit.sk
pterophyllumfishfarm.skPterophyllum fish farm
ptm.skptm.sk
ptr-trade.skPTR TRADE
puart.sk
publicon.sk- EXO HOSTING - webhosting, domény
pucovachata.skPucova chata | na Skalke
pulitzer.skPulitzer
pullbloc.sk- EXO HOSTING - webhosting, domény
pulovre.skVáš webhosting neexistuje | Websupport.sk
pulu.sk
pulvis.skPulvis s.r.o. - renovácia tlačových kaziet
puma-noze.sk- EXO HOSTING - webhosting, domény
pumpar.skPumpár
punpon.sk
puntanela.sk- EXO HOSTING - webhosting, domény
puntickar.skRekonštrukcie bytov, domov, rekonštrukcie bytových jadier, Trenčín Puntičkár
pup.sk- EXO HOSTING - webhosting, domény
pure-home.sk
push-up.sk
pushme.skPUSH ME ~ Digital Startup Agency
pushup.skSpodné prádlo | podprsenky | korzety | plavky - Pushup.sk
puskohlad.skPUŠKOHĽAD
puskohlady-dalekohlady.skPuškohľady, ďalekohlady a príslušenstvo svetových značiek
puskohladyshop.skRifleopticshop
puta.sk- EXO HOSTING - webhosting, domény
putace.sk- EXO HOSTING - webhosting, domény
puterova.skJanka Puterová | študentka FIT VUT Brno, programátorka
putsko.skwww.putsko.sk
putzmeister.skKOLEX
puwa.sk
puzdra-obaly.skPuzdra-obaly.sk
puzzle-production.skPuzzle Production - Event management
puzzleproduction.skPuzzle Production - Event management
pvmont.skPVMONT, s.r.o.
pvmsystem.sk
pvo.sk
pwd.skGrafické štúdio - www stránky, reklama, marketing, grafika, web design
pxxcomm.skParadoxx Communications
pypos1.skGraffiti Airbrush Design
pyramidkykorenia.skÚvod | Pyramídky korenia
pyramidovevsetko.skVitajte !
pyramidyvbosne.sk
pyro-shop.sk
pyroman.skPyroman - zábavná pyrotechnika - predaj
pyrotechnika-shop.sk- EXO HOSTING - webhosting, domény
pz-poistenie.skVAŠAPOISTKA - Váš poradca pri poistení
pz-roznava.sk- EXO HOSTING - webhosting, domény
pzbielykamen.skPZ Biely Kameň Domadice - PZ Biely Kameň
pzgemer.sk- EXO HOSTING - webhosting, domény
pzkonart.sk- EXO HOSTING - webhosting, domény
pzplesivec.sk- EXO HOSTING - webhosting, domény
pzponitran.skPZ Ponitran Ludanice
pzroznava.sk- EXO HOSTING - webhosting, domény
pzskalka.sk
pztrencianskestankovce.sk
q-azy.skq-azy.sk | Home
q-net.skQ-net internet
q2612-cb435a-cb436a-fx10-crg728-ce278a-ce285a.skHľadám toner
q2612a-cb435a-cb436a-fx10-crg728-ce278a-ce285a.skHľadám toner
q2612a.sk
qantegra.sk- EXO HOSTING - webhosting, domény
qantica.skqantica
qatar.skQatar - letenky
qbe-po.sk
qbepoistovna.skVAŠAPOISTKA - Váš poradca pri poistení
qfotograf.skStránka fotografa q fotograf
qigong.skQIGONG
qintec.skQintec s.r.o.
qm.skqm.sk
qmagazin.sk
qnet.skwww.qnet.sk
qocpartners.skQ&OC Partners, s.r.o.
qpg.skQPG
qprojekt.skQ-PROJEKT PLUS, s.r.o.
qrklucenka.sk- EXO HOSTING - webhosting, domény
qsb-dosky.skexample.com
qsbdosky.skDomov | qsbdosky.sk
qshop.ske-Obchod.Tujeto.sk
qshs.skQSHS: Ing. Miroslav Osuský - QSHS | Pomáhame Vám rásť !
qtherm.skQ-THERM Dovoz a distribúcia v SR
quadalkatreszek.skWelcome
quadcoptery.skQuadcoptery.sk
quadmoto.skwww.QUADMOTO.sk
quadpneu.sk
quadrom.skQUADROM | Požičovňa štvorkoliek
quadsport.skQUADSPORT.sk | Náhradné diely a príslušenstvo pre štvorkolky
qualcomp.skQualComp.sk – špičkový počítač až ku Vám domov
qualicum.skHome
qualisyst.skQualisyst.sk - to podstatné o kvalite
quantex.sk
quantmax.sk
quasar.skÚvod
queenspub.skQueen's pub Púchov - Novinky
questnet.skIIS7
queves.sk
quickservice.skQuickservice.sk
quote.sk- EXO HOSTING - webhosting, domény
qyx.sk
r-art.skProjekty rodinných domov a stavieb - Ing. arch. Radovan Jankovič
r-klub.skR-klub, ultrazvuková liposukcia
r-media.sk
r-service.skr-service.sk r-service
r-ski.skR-SKI - Flash úvod
r0.sk
r00t.sk
r2-design.skVermont Design
r2r.sk- EXO HOSTING - webhosting, domény
r35.sk- EXO HOSTING - webhosting, domény
raasch.skÚvod - raasch je výrobca a európsky partner profesionálnych upratovacích firiem
rabac.skApartmány Rabac a Labin , Chorvátsko - Dovolenka Chorvátsko 2014, Ubytovanie v Chorvátsku Apartmány a Hotely, Dovolenkové domy Vily Dovolenkové rezorty Mobilné domy Penzióny Plavby Jachting
racek.skProfil spoločnosti RAČEK
racer-dip.skRACER DIP | Viacúčelový syntetický gumený náter
rachler.skO nás | Rachler.sk
racingwheels.skRacingWheels
racioenergia.sk- EXO HOSTING - webhosting, domény
raciofit.skRaciofit - O nás
raciohouse.skNízkoenergetické domy .::. NED
raciotherm.skVykurovanie, plynofikácia, zdravotechnika, vzduchotechnika, meranie a regulácia - Raciotherm, s.r.o.
raciotrade.sk- EXO HOSTING - webhosting, domény
radecom.sk
radesit.skRADESIT, s.r.o.
radicalfluid.skGIG
radikalnastrana.skRadik
radiocare.skRadiocare krém
radiofolklor.sk- EXO HOSTING - webhosting, domény
radiotel.sk
radiotwist.sk- EXO HOSTING - webhosting, domény
radisdetmi.skHlavná stránka
radiva.skRadiva
radixon.skRADIXON - Surveillance and Monitoring Solutions for the 21st Century
radka.sk
radlinka.skRADLINKA.SK
radobabiak.skRADO BABIAK - kandidát na primátora mesta Spišská Stará Ves
radodesign.sk- EXO HOSTING - webhosting, domény
radomasaryk.skAkademický a aplikovaný výskum, Tlmočenie a prekladanie z/do angličtiny - Radomír Masaryk
radostnakupovat.sk- EXO HOSTING - webhosting, domény
radostnesrdce.skwww.radostnesrdce.sk
radostnydomov.skRadostný domov
radovanmisiak.sk
radylekara.skVšeobecný lekár, môj lekár | Rodinný lekár
rafting-pieniny.skRafting-pieniny - Úvod
raftingadventure.skRafting, štvorkolky, požičovňa, firemné akcie - RAFTINGADVENTURE
raftingpieniny.skrafting-pieniny - Úvod
raftklub.sk
raftys.sk
ragdollssong.skRagdoll's Song - ragdoll cattery
raimondinaradie.skÚvod
rain-bird.skZavlažovacie systémy | Rain Bird Slovensko
rainbow-club.skRAINBOW-CLUB.sk | Hlavná stránka
rainbowhill.skrainbowhill.sk › Prihlásiť sa
raj-nakupov.sk
raj-nakupu.sk
raj-pneu.sk- EXO HOSTING - webhosting, domény
rajareality.skRAJA - realitná kancelária - predaj domy, byty, pozemky
rajdeti.skDetský tovar - Raj Detí
rajdovoleniek.sk- EXO HOSTING - webhosting, domény
rajec-apart.skRajec - Rajecká dolina - ubytovanie - apartmány
rajelektra.sk- EXO HOSTING - webhosting, domény
rajelektro.sk- EXO HOSTING - webhosting, domény
rajka-reality.skRAJKA RAJ - realitná kancelária
rajkareality.skRAJKA RAJ - realitná kancelária
rajkobercov.sk- EXO HOSTING - webhosting, domény
rajkocikov.sk- EXO HOSTING - webhosting, domény
rajmobilov.sk- EXO HOSTING - webhosting, domény
rajmody.sk- EXO HOSTING - webhosting, domény
rajnabytku.sk- EXO HOSTING - webhosting, domény
rajnakupov.sk
rajnakupu.sk
rajnechtov.sk- EXO HOSTING - webhosting, domény
rajoblecenia.sk- EXO HOSTING - webhosting, domény
rajobrazov.sk- EXO HOSTING - webhosting, domény
rajparfemov.sk- EXO HOSTING - webhosting, domény
rajprezeny.sk
rajteplice.skChata RajTeplice
rajzdravia.sk- EXO HOSTING - webhosting, domény
rako-keramika.skRako, s. r. o. | Keramika Nábytok
rakovo.skOficiálna internetová stránka obce Rakovo
rakuske-ck.skRakúske cestovné kancelárie | E-cestovka.sk
rakuskeck.skRakúske cestovné kancelárie | E-cestovka.sk
rakytnikcentrum.skTarovsky - produkty z rakytníka
rakytovce.skBB-REALITY | PREDÁVATE, KUPUJETE ALEBO PRENAJÍMATE NEHNUTEĽNOSŤ?
rallyetatry.skRALLYE TATRY POPRAD
rallytatry.skRALLYE TATRY POPRAD
ramal.sk- EXO HOSTING - webhosting, domény
rameco.sk
ramis-eu.skRamis-eu | Teplo budúcnosti | Slnečné lúče vo Vašom dome!
ramovaniebratislava.skPhotoprint - Uvod
rampal-latour.sk
ramus.sk- EXO HOSTING - webhosting, domény
ramynafotky.skRámy na fotky predaj online eshop cena kúpiť
ramynaobraz.skRámy na obrazy predaj online eshop predaj cena kúpiť
ramynaobrazy.skRámy na obrazy online eshop
rana.skSzabolcs Rana | nápad | tvorba
ranavedla.skRana vedľa | Keď fujara vystrelí…
rancbora.skRanč Bôra
ranczabokreky.skRanč Žabokreky
ranczlatyvrch.skZivot s konmi
randar.skSlavo - osobná web stránka
randepreteba.sk--> Rande: Speed Dating
rapidweb.skHome | rapidweb.sk
raptape.skRap & hip-hop magazín a videoarchív | Raptape.tv
raslavice.skOficialna stránka obce RASLAVICE
raspberry.sk
rassi.skRáššiovci - rodinná stránka
rastislavice.skKalvín Rastislavice : Kalvín Rastislavice - Miesto pre zdravý život
rastislavkunst.skMgr. Rastislav Kunst
rastislavmedved.sk- EXO HOSTING - webhosting, domény
rastislavtrnka.skRastislav Trnka
rastobielik.skRasťo Bielik - Silné Slovensko v EÚ
rastosobnosti.skCentrum pre rast osobnosti - Domov
ratajsk.skRATAJ SK
ratanove-sedenie.sk
ratiko.sk::: RATIKO a. s. - Váš technologický partner :::
ratko.skwww.ratko.sk
ratnovce.skwww.ratnovce.sk
ravagroup.skRAVA GROUP s.r.o.
ravenclaw.skRavenclaw Website
ravens.sk
ravika.skZdravotnícke zásobovanie, chirurgický šicí materiál,chirurgické rukavice, obväzy, gáza, kovo inštrumenty, medicinálne filmy, infúzne sety, ortopedické pomôcky, chirurgické šicie ihly, Ravika spol. sr.o.
ravo.skRAVO
ravson.skRavson - Tepelné izolácie - fibrostir
rawgaia.sk
rawlin.skRAWLIN
rayblog.sk
raychemkurenie.sk- EXO HOSTING - webhosting, domény
rayfix.sk- EXO HOSTING - webhosting, domény
rayovac.sk- EXO HOSTING - webhosting, domény
razga.sk
razor.skrazor.sk home page
razsochy.sk- EXO HOSTING - webhosting, domény
razusova.sk- EXO HOSTING - webhosting, domény
rb-elin.sk
rbd.skPoradenstvo v oblasti financovania obnovy bytových domov - RBD s.r.o.
rbgslovakia.skRBG SLOVAKIA
rbplast.skRB Plast
rbplastmont.sk- EXO HOSTING - webhosting, domény
rc-slovakia.sk
rc4x4.skrc4x4.sk
rcars.skR Cars - autobazár
rccomorra.skRC Comorra | modelársky klub Komárno
rcd.sk
rcentrum.sk
rcklubds.skRC Klub Dunajsk
rcmktrnava.skRC Model klub Trnava | Stránka leteckých modelárov z Trnavy a okolia
rconsulting.skR – Consulting : Quality – Consulting – Control – Measuring
rcpservis.skRCP servis - predaj a servis kancelárskej techniky
rcslovakia.skRC Slovakia
rczakladna.skRC letecké základne Medzilaborce, Michalovce, Sečovce, Strážske, Trebišov, Vranov nad Topľou
rczolna.skRC Zolná.sk | stránka pilotov letiska Zolná
rdacoustic.skRD Acoustic™ - High-End Audio and PC for everyone
rdarchitekt.sk
rdc.skSunflowers Round Dance Club, Dominika Šindlerová, Juraj Cháron Šindler, svadba Veronika Šindlerová (Vrbová)
rdh.sk
rdkostany.skRODINNÉ DOMY Košťany nad Turcom
rdlhos.skIng.Róbert Dlhoš - znalec v odbore poľnohospodárstvo, odvetvie odhad hodnoty polnohospodárskej pôdy, spracovanie bilancie skrývky, rastlinná produkcia, živocíšna produkcia.
rdprojekt.skRDPROJEKT - architecture design
rdrymarov.skRD Rýmařov - Rodinné domy
rdssklenarova.skRužinovský domov seniorov Sklenárova 14: Titulka
rdzakamenne.skRD Zákamenné
re-os.skRE-OS s.r.o., výroba reklamných predmetov a darov, marketing, potlač, kalendáre
ready2run.skReady 2 Run - špecializovaný obchod pre bežcov
reakcia.sk- EXO HOSTING - webhosting, domény
real-audit.skREAL-AUDIT - Vitajte
realbau.sk
realdata.sk, realdata.sk webhosting a registrácia domény, domeny, registracia stranky, webdizajn
reale.skSprostredkovanie predaja, kúpya prenájmu nehnuteľností
realestateagency.sk- EXO HOSTING - webhosting, domény
realhosting.skRealHosting.sk webhosting a registrácia domény, domeny, registracia stranky, webdizajn
realitacik.sk- EXO HOSTING - webhosting, domény
realitna-inzercia.skRealityPD.sk
realitnainzercia.skRealityPD.sk
realitnakariera.skRealitná kariéra | Texico reality
realitnenovinky.sk- EXO HOSTING - webhosting, domény
realitny-poradca.sk
realitnyagentkupujuceho.skRealitný maklér kupujúceho | Jedinečná služba na Slovensku, štandard vo svete
realitnymaklerkupujuceho.skRealitný maklér kupujúceho | Jedinečná služba na Slovensku, štandard vo svete
realitos.skProperties-o Properties for Sale | REALITY
reality-bb.sk- EXO HOSTING - webhosting, domény
reality-brezno.skNehnuteľnosti, byty, pozemky, domy, predaj, prenájom. - Vitajte
reality-byty-domy-pozemky.skReality Velvet-real.sk , reality, byty
reality-cs.sk
reality-inzercia.skREALITY INZERCIA, predaj a prenájom bytov, rodinných domov, nehnutelností
reality-isbg.sk- EXO HOSTING - webhosting, domény
reality-kupa-predaj.sk
reality-no1.skREALITY No1
reality-nz.skWeb REALITY NZ na predaj !!!
reality-ok.skRealitná kancelária - www.reality-ok.sk
reality-pd.skDOBRÉ REALITY s.r.o. predaj domov a bytov, chaty, pozemky, priestory, prenájom nehnuteľností, reality, výkup realít - Realitná spoločnosť Dobré Reality
reality-poprad-tatry.sk- EXO HOSTING - webhosting, domény
reality-portal.sk- www.realdata.sk - Vas profi webhosting
reality-stavby.skReality - stavby, s.r.o. , realitná kancelária - reality, nehnuteľnosti, pozemky, domy, byty, chaty, chalupy a podnikateľské objekty z regiónu Orava (Dolný Kubín, Námestovo, Trstená, Tvrdošín)
realitybanskabystrica.skBB-REALITY | PREDÁVATE, KUPUJETE ALEBO PRENAJÍMATE NEHNUTEĽNOSŤ?
realitybn.skRealityPD.sk
realitybystrica.skBB-Reality s.r.o. - PREDAJ, PRENÁJOM, KÚPA, VÝMENA NEHNUTEĽNOSTÍ
realitydk.skREALITY DK - - PREDAJ, PRENÁJOM NEHNUTEĽNOSTÍ, BYTY, DOMY, POZEMKY, CHALUPY
realitydubaj.sk
realityfr.sk- EXO HOSTING - webhosting, domény
realityisbg.sk
realitymadarsko.skReality Maďarsko - realitná kancelária
realitymarta.skRealitná kancelária - MARTA
realitymax.skRealityMAX
realitymichalovce.skReality Michalovce - realitná kancelária
realitymk.sk..: WWW.REALITYMK.SK :..
realitypd.skRealityPD.sk
realitypiestany.skRealityPD.sk
realitypoprad-tatry.sk- EXO HOSTING - webhosting, domény
realitypopradtatry.skReality Poprad Tatry - Úvod
realitypovazie.skReality Považie - Home
realityprievidza.skRealityPD.sk
realitystavby.sk- EXO HOSTING - webhosting, domény
realitytatrypoprad.sk- EXO HOSTING - webhosting, domény
realitytn.skRealityPD.sk
realityto.skRealityPD.sk
realitytopolcany.skRealityPD.sk
realitytrencin.skRealityPD.sk
realityvideo.sk
realityvychodu.sk
realizaciazahrad.skREALIZÁCIA ZÁHRAD
realizaciestavieb.sk
realking.sk- EXO HOSTING - webhosting, domény
realkorp.skReality a korporácie, s.r.o.
realnabytok.skRealnabytok - ONLINE nábytok za skvelé ceny
realprosperity.sk
realway.skNa stránke sa pracuje
realwear.sk
reaxlv.sk- EXO HOSTING - webhosting, domény
rebauman.skREBAUMAN s.r.o.
rebplast.skKvalitné plastové okná a garážové brány | RebPlast
rebreather.skJML-DIVING Sofnolime wapno sodowane pochłanianie CO2
rebreatherccr.skJML-DIVING Sofnolime wapno sodowane pochłanianie CO2
reccom.skRECCOM s.r.o.
recenziefiriem.skRecenzie firiem, overené firmy, hodnotenia a zoznam firiem
recenzuj.sk
receptaren.skReceptáreň.sk
receptarik.sk
receptik.skNajnovšie recepty // Receptik.sk
recode.skRe-Code Slovensko
recolor.skRecolor - reklama pre Vás
recoma.skECO Media
reconyx.sk- EXO HOSTING - webhosting, domény
recykloart.sk
red4u.sk- www.exohosting.sk - Vás profi webhosting
redakcia.sk
redakcnysystemtypo3.skTYPO3 Content Management System | BSP Magnetica
redbox.skwww.REDBOX.sk
redboxpizza.skÚvodná strana
redcast.skZákazková výroba šperkov.
rederm.skReDerm, s.r.o.
redhammer.skRobert Redhammer
redinex.skredinex.sk - DDD
redix.sk
redken.skRIDANI I.H.S. - we use only REDKEN
redlines.skOdpadové hospodárstvo - RedLine`s, s.r.o.
redpodhajska.skÚvod
redtulip.skRED TULIP s.r.o
reelzar.skREELZAR s.r.o. - Najľahšie zarobené peniaze sú tie ktoré neminiete
reemautoservis.skProfesionálny servis vozidiel BMW v Žiline | REEM autoservis
reesma.sk
reeve.sk
refanshop.sk
refdiakonia.skDiakónia | Szlovákiai Református Keresztyén Egyház
reference.sk
refex.sk- EXO HOSTING - webhosting, domény
refgomor.skGömöri Református Egyházmegye
refinancovanie-uverov.skRefinancovanie úverov
reflex-bau.sk- EXO HOSTING - webhosting, domény
reflexnaterapia.sk- EXO HOSTING - webhosting, domény
reflexneterapie.sk
reformata.skReformata.sk| Nyitóoldal
reformatus.sk
reformbusiness.skNemecký jazyk | Úvod | www.reformbusiness.com
reformdeutsch.skNemecký jazyk | Úvod | www.reformdeutsch.com
reformenglish.skNemecký jazyk | Úvod | www.reformdeutsch.com
reformjob.skNemecký jazyk | Úvod | www.reformjob.com
reformkosice.skREFORM Košice | O spoločnosti
refszakallas.skApácaszakállasi Református Gyülekezet | Az Isten szeretet.
refvaly.sk
refzene.skegyházzene
regaly-police.sk- EXO HOSTING - webhosting, domény
regalypolice.sk- EXO HOSTING - webhosting, domény
regarch.sk- EXO HOSTING - webhosting, domény
regardfight.sk- EXO HOSTING - webhosting, domény
regart.skÚvod
regas.skRegále, regálové systémy, regály, kovový nábytok, prepravky
regastav.skwww.regastav.sk | PROFIL SPOLOČNOSTI
regeneraciapleti.sk- EXO HOSTING - webhosting, domény
regenerator.skREGENERATORS
regetovka.skRegetovka, Stebnícka Huta
regidis.skRegidis s.r.o.
regionalnamototechna.sk- EXO HOSTING - webhosting, domény
regiondirect.sk
regiongron.sk
regionmessenger.skregionMESSENGER
regiontirnavia.sk
regionturiec.sk- EXO HOSTING - webhosting, domény
regiovision.skStripe
registerklubov.sk
regno.sk- EXO HOSTING - webhosting, domény
regulaciakotolni.skHome
regulacnatechnika.sk- EXO HOSTING - webhosting, domény
regulaservis.skREGULA SERVIS index_sk
rehab.skVitalrehab Bratislava
rehabilitacnesluzby.skRehabilitačné Služby
rehabka.skMudr. Katar
rehaem.skREHAEM
rehapro.skÚvod
rehoff.sk
reic.skaktuality
rein.sk- EXO HOSTING - webhosting, domény
reina.skReina.sk
reint.skDomů
reja.skReja Catering s.r.o.
rejduga-stavby.skHrubé stavby, zateplenie budov, omietky, interiér - REJDUGA
rek-lama.sk
reklama-bratislava.sk- EXO HOSTING - webhosting, domény
reklamaled.skSvetelná LED reklama - WWW.REKLAMALED.SK
reklamapresov.skReklama Prešov, výroba reklamy, reklamné tabule, reklamné pútače, webdizajn, advertising, webdesign, webdizajn Prešov, webdesign Prešov, reklama pre obce, obce, Košice, reklama Košice, web, webstránky, korporátna identita firiem, reklamné tabule, výlep au
reklamna-agentura-bratislava.sk- EXO HOSTING - webhosting, domény
reklamna-agentura-nitra.skReklamna agentura v Nitre, ktorá vyrobí nie len reklamné predmety / Plavák s.r.o.
reklamna-plocha.sk- EXO HOSTING - webhosting, domény
reklamnaagenturabratislava.sk- EXO HOSTING - webhosting, domény
reklamnafirma.sk- EXO HOSTING - webhosting, domény
reklamne-agentury.sk- EXO HOSTING - webhosting, domény
reklamne-miesta.sk- EXO HOSTING - webhosting, domény
reklamne-miesto.sk- EXO HOSTING - webhosting, domény
reklamne-plochy.sk- EXO HOSTING - webhosting, domény
reklamne-prace.sk
reklamne-predmety-nitra.skReklamna agentura v Nitre, ktorá vyrobí nie len reklamné predmety / Plavák s.r.o.
reklamne-priestory.sk- EXO HOSTING - webhosting, domény
reklamne-sluzby.sk- EXO HOSTING - webhosting, domény
reklamne.skHome - reklamné.sk
reklamnemiesta.sk- EXO HOSTING - webhosting, domény
reklamnemiesto.sk- EXO HOSTING - webhosting, domény
reklamnepotlace.skPotlač textilu
reklamneprace.sk
reklamnepriestory.sk- EXO HOSTING - webhosting, domény
reklamnetabule.skwww.REKLAMNETABULE.sk - Reklamne tabule, firemne tabule, informacne tabule, smerove a informacnestitky, dopravne,znacky, firemne loga;, popisovanie strojov a zariadeni,
reklamny-priestor.sk- EXO HOSTING - webhosting, domény
reklamnyfilm.skhttp://www.reklamnyfilm.sk
reklamozruti.sk- EXO HOSTING - webhosting, domény
rekob.skRekonštrukcie a obnovy budov | Rekob, s.r.o.
rekonhal.skREKONHAL s.r.o.
rekonstav.sk
rekonstrujeme.skRekonštrujeme.sk - Uvod
rekonstrukciabytovehojadrapoprad.skRekonštrukcia bytového jadra Poprad - prestavba bytového jadra a bytu v Poprade.
rekonstrukciainterieru.sk
rekonstrukcie-drekon.skDrekon
rekonstrukciebytovychjadier.skRekonštrukcie bytov, bytových jadier, prestavba bytov, rekonštrukcia kúpeľne, rekonštrukcia bytu v Bratislave, Trnave a okolí
rekonstrukcievranov.skPatrik Pollák - Rekonštrukcie rodinných domov
rekonstrukt.skÚvod - Stavebné práce, Dolný Kubín, Ružomberok, Martin, Žilina, Maliarske a omietarske práce Miroslav Varešák
rekonstruuj.skwww.rekonstruuj.sk
rekony.sk- EXO HOSTING - webhosting, domény
rekop.skREKOP Humenné s.r.o.
rekopmont.skDomov | RekOpMont
rekoweb.skwww.rekoweb.sk
rekreacnechalupy.sk
rekreacnydom.sk
rekreo.sk
rela.skObuv RELA
relax-creativetherapy.skRELAX - CREATIVE THERAPY Monika Gramatova
relax-team.skReštaurácia Relax - denné menu, obedové menu
relax1.skRELAX Prievidza - reštaurácia, ubytovanie
relaxacik.skSúkromné centrum voľného času Relaxáčik - Nové
relaxazdravie.skMasérsky salón Relax a Zdravie Kežmarok
relaxharmony.skRelaxHarmony.sk
relaxica.sk
relaxsalon.skMasáže - Štúdio RELAX, Nám. Oceliarov 23, Košice - Šaca, tel. 0915 318 140
relaxtime.sk- EXO HOSTING - webhosting, domény
relaxuhliska.skSKINIŽNÁ UHLISKÁ | Ubytovanie
relbit.sk- EXO HOSTING - webhosting, domény
rele.skELKO EP SLOVAKIA, s. r. o. | Relé od A do Z | Elektronické prístroje
relevant.skRelevant n.o. - Sme tu pre tých, ktorí to potrebujú.
reliagroup.skRelia-Group Slovakia
relias.skRelias.sk | Reality, nehnuteľnosti, spolubývanie
relock.skRELOCK, s. r. o.
rema-hudec.skŠport | Rema-Hudec
remaart.sk
remaslovakia.skNOVINKA
rematel.skElektroinštalácie od projektu po revíznu správu
remavia.skRemavia
remaxpresov.sk
remek.skSoftware pre obce, mestá a školy • Remek
remireality.skRemi reality – realitná kancelária, predaj nehnuteľností, byty, domy a chaty
remko-cerva.skREMKO s.r.o. - Ochranné pracovné oblečenie, obuv, náradie a materiál na čalúnenie - Úvod
remointerier.skREMO interiér / podlahy, kuchyne, šatníky, dvere
remonel.skÚvod - Remonel s.r.o.
remp.skE-Shop REMP s.r.o.
remponitra.skRempo - Všetko pre Vašu bezpečnosť pri práci - Úvod
renad-stav.skRENADSTAV, s.r.o. - konečne dobrá stavebná firma
renadstav.skRENADSTAV, s.r.o. - konečne dobrá stavebná firma
renarnabytok.skRenar nábytok
renat.skRenat.sk spol, s r.o. - Tvorba web stránok
renataspackova.skRenata Špačková | Osobná stránka
rener.skRenner - Informačné technológie, software pre skladové hospodárstvo a registračné pokladne
renewalagency.skRenewal agency
renky.skHome