Obchodné meno registratora EXO TECHNOLOGIES spol. s r.o.
Identifikator registratora EXOT-0004
Adresa Garbiarska 3, Stará Ľubovňa
Telefón +421221028430
E-mail support zavináč exohosting bodka sk
pizzaromana.skPizza ROMANA
pizzaroznava.skPIZZA ROŽŇAVA | Donášková služba - zdarma
pizzasiesta.sk- EXO HOSTING - webhosting, domény
pizzatrnava.skPizza Trnava - Donáška pizze a jedál v Trnave, donášková služba, rozvoz pizze
pizzaweb.sk- EXO HOSTING - webhosting, domény
pizzeria-luky.skwww.pizzeria-luky.sk - Domov
pizzeria-tiffany.skPizzeria Tiffany
pizzeriaallfood.skDonášková služba ALL FOOD
pizzeriaantonio.skPizzéria Antonio - Vranov nad Topľou
pizzeriadellapiazza.skPizzeria della Piazza      Untitled Document
pizzeriafontana.skPizzéria Fontána, Levice - reštaurácia, denné menu, rozvoz pizze
pizzeriamarcello.skPizzeria Marcello
pizzeriaromantica.skPizzeria Romantica
pizzeriatalia.skO nás
pizzeriataverna.skPizzeria Taverna
pizzerky.skPizzerky.sk - kam pôjdeme na pizzu?
pjcolours.skP & J COLOURS, spol. s r.o.
pjklamp.skPJ KLAMP Pavol Janec
pk-systems.skPK systems
pk-taxi.skPK-TAXI Osobná doprava non-stop
pkazeta.skKurzy plávania, plavecké kurzy, plávanie, Bratislava, Senec
pkbb.skFakturačný system
pkmoto.skpkmoto.sk - oleje, sviečky, filtre, aditíva, autožiarovky, autokozmetika, reťaze
pkproduction.skPK Production
pks-mont.skPKS - Mont s.r.o.
pkstav.skPK Stav
pktaxi.skPK-TAXI Osobná doprava non-stop
pkv.sk- EXO HOSTING - webhosting, domény
placidus.skWellness penzión Placidus I Prešov
placko.sk- EXO HOSTING - webhosting, domény
plafony.skPlafony.sk - dostupný luxus aj pre Vás
planes.sk:. PRIPRAVUJEME .:
planeta-darcekov.sk- EXO HOSTING - webhosting, domény
planetaziaroviek.skŽiarovky, žiarivky, automobilové žiarovky, úsporné žiarivky, výbojky | planetaziaroviek.sk
plans.skPlans s.r.o.
plast-kov.skDokonalá symbióza plastu a kovu - PLAST-KOV s.r.o.
plastove-okna-dvere-nitra.skHoupTaid s.r.o. Nitra - Kvalitné plastové, drevenné a hlinikové okná a dvere
plastove-vyrobky.sk:: Arto Slovakia, s.r.o. :: - Úvod
plastovemechy.skPlastové měchy
plastoveokna-klacansky.skPlastové okná Nitra - Klačanský
plastovepuzdra.skPlastové puzdra
plastovesudy.skPredaj plastových sudov | PlastovéSudy.sk
plat4m.skDizajnovo-orientovaná digitálna agentúra PLATFORM
platanplus.skSpiľovanie a výrub stromov v rizikových podmienkach - PLATAN Zvolen
platformy.sk- EXO HOSTING - webhosting, domény
platim-nedlzim.skPrevencia vzniku pohľadávok | Prečo platiť
platno.sk- EXO HOSTING - webhosting, domény
platobny-rozkaz.skPlatobný rozkaz | Lanikova Group s.r.o.
plauterkuria.skHotel *** Plauter Kúria | Ubytovanie Veľký Meder
plavajuce-sviecky.sk- EXO HOSTING - webhosting, domény
plavbapodunaji.skPrenájom lodi
plavebnykongres.skSlovenský plavebný kongres - DOMOV
plaveckaakademia.skPlavecká Akadémia - Plávanie, plavecké kurzy |
plaveckymikulas.skwww.plaveckymikulas.sk - Hlavná stránka
plaveckystvrtok.sk- EXO HOSTING - webhosting, domény
play-school.skPlay SCHOOL
playboy-shop.sk- EXO HOSTING - webhosting, domény
playexpo.skPlayExpo 2015
playmax.skPlayMAX | Vitajte v sieti PlayMAX
playon.skPlayON | life is a game
playsonor.skWelcome to the Frontpage
playstation5.sk- EXO HOSTING - webhosting, domény
plazy.sk- EXO HOSTING - webhosting, domény
plconsulting.skPLC International s.r.o. - O Spoločnosti
plechova-garaz.skStanel s.r.o.
plechovagaraz.skBOMSTAL Slovakia, s.r.o. Plechové montované garáže, záhradné domčeky, sklady
plechove-garaze.skPlechové garáže, stavebné búdy, záhradné domčeky - domáca stránka
plechovedomceky.sk- EXO HOSTING - webhosting, domény
plechovegaraze.skPlechové garáže, stavebné búdy, záhradné domčeky - domáca stránka
plestinska.skZita Pleštinská
pletove-masky.sk- EXO HOSTING - webhosting, domény
plnohodnotnyzivot.skPlnohodnotný život | Stránky Plnohodnotný život“ sú tu na to, aby pomohli ľuďom s ochrnutím zaradiť sa do života čo najjednoduchším spôsobom a čo najproduktívnejšie.
plochynaprenajom.sk- EXO HOSTING - webhosting, domény
plod.sk- EXO HOSTING - webhosting, domény
plodiny.skPlodiny.sk | Nákup potravinárskej pšenice a raže!
plodoovoc-contexo.skVýroba vína Michalovce
plosinystraka.skRoman Straka, PlosisnyStraka.sk
plp.skVaP Slovakia
plska.skUntitled Document
plucnaambulancia.skPľúcna Ambulancia :: Novinky
plusdigital.skPlus Digital
plusminus.sk- EXO HOSTING - webhosting, domény
pluspromotion.skPlus Promotion Bratislava s.r.o.
plyn-voda.skGemerTerm - projekcia s.r.o.
plynas.skPlynas s.r.o.
plynmont.skPlynmont - PLYNMONT, stavebné práce
plynmonthe.skPlynmont - PLYNMONT, stavebné práce
plynokontrol.skPLYNOKONTROL - odborné prehliadky a skúšky plynových zariadení
plynovapistol.sk- EXO HOSTING - webhosting, domény
plynovepistole.sk- EXO HOSTING - webhosting, domény
plynovy-gril.skFireDesign - luxusné plynové grily a vonkajšie kuchyne
plysove.sk- EXO HOSTING - webhosting, domény
pmacko.skPeter Mackovčiak
pmagency.skNetLas s.r.o.
pmbstav.skPMB-stav s.r.o. - Stavebné, zemné a betonárske práce
pme.skPME.sk - Project engineering
pminvention.skOpus, -všetko pre vás
pmjstav.skPMJSTAV.sk - ploty, dlažby, drobné stavby
pmkbujnakova.skJUDr. Emília Bujňáková
pmklima.skKlimatizácia a vzduchotechnika - (Poprad) PM KLIMA - Klimatizácia do Vášho domu
pmprofit.skPM Profit Management (c)2008
pmshop.skOpus, -všetko pre vás
pmtrans.skpmtrans |
pmv.sk- EXO HOSTING - webhosting, domény
pneuakcia.skHome page
pneufol.skPneufol - Pneuservis, Autofólie
pneukosice.skVitajte | Pneuservis Košice | A STEEL s.r.o.
pneumant.skAuto Market Slovakia s. r. o.
pneumatiky-falconia.skEshop falconia
pneumatiky-yokohama.skPredaj pneumatík a diskov, Pneumatiky a disky Bratislava | MG pneu
pneumatikybratislava.skPneumatiky Bratislava, Pneumatiky a Disky za skvelé ceny
pneumatikykosice.skVitajte | Pneuservis Košice | A STEEL s.r.o.
pneumatikyonline.skPredaj pneumatík a diskov, Pneumatiky a disky Bratislava | MG pneu
pneumaxim.sk..: PneuMaxim:..
pneupredaj.sk- EXO HOSTING - webhosting, domény
pneuservis-bratislava.sk- EXO HOSTING - webhosting, domény
pneuserviskosice.skVitajte | Pneuservis Košice | A STEEL s.r.o.
pneuservisnonstop.skPneuservis nonstop | AL s.r.o.
pneuspis.sk- EXO HOSTING - webhosting, domény
pneuvilko.skPneuservis Vilček Ľubomír, Podolínec
po-city.skPrešovský filmový festival - Program
po30ke.sk- EXO HOSTING - webhosting, domény
pochod.skPieninský pochod dobrej nálady
pochutka.sk- www.exohosting.sk - Vás profi webhosting
poci.sk- EXO HOSTING - webhosting, domény
pocisk.sk- EXO HOSTING - webhosting, domény
pocitace-zilina.skHACOM Žilina | predaj a servis PC/SAT | Internet | E-shop
pocketwizard.skPocketWizard | Slovensko
pod-cenou.skZľavy dňa | Podcenu.sk
pod-cenu.skZľavy dňa | Podcenu.sk
podajdalej.skPodaj ďalej | Daruj radosť - daj veciam druhú šancu
podbranisko.sk- EXO HOSTING - webhosting, domény
podcenou.skZľavy dňa | Podcenu.sk
podcenu.skZľavy dňa | Podcenu.sk
podhajska-belek.skBelek *** privat
podhajska-vaclavova.skÚvod - Ubytovanie v Podhájskej
podhajska-zatisie.skApartmány v zátiší - Podhájska
podhajska342.skUbytovanie Podhájska 342
podhajska345.skPODHÁJSKA - UBYTOVANIE | Apartmány Sulamit
podhradieinvest.sk- EXO HOSTING - webhosting, domény
podia.sk- EXO HOSTING - webhosting, domény
podium.skProfesionálne pódium Nivtec Flexibel
podkmoru.skPOD K MORU
podlahauz.skpodlaha podľa ha-uz | Riešenia
podlahove-vysavace-brusky-automaty.skPriemyselné vysávače, podlahové vysávače, podlahové brúsky, podlahové umývacie automaty.
podlahovekurenie.skFirma NOVAK - podlahové kúrenie, tepelné čerpadlá
podlahy-krupa.skUntitled Document
podlahydverebytca.skTvorba web stránok | EDMAX, s.r.o.
podlazikom.skUbytovanie na Liptove-Chata pod Lazíkom
podlozkapodstolicku.skPodložka pod stoličku
podlozkypodspz.sk- EXO HOSTING - webhosting, domény
podlozkyspz.sk- EXO HOSTING - webhosting, domény
podmedochalupky.skPoďme Do Chalúpky – rýchle občerstvenie , firemné a súkromné akciePoďme Do Chalúpky – rýchle občerstvenie , firemné a súkromné akcie
podmehrat.sk- EXO HOSTING - webhosting, domény
podmienky.sk- EXO HOSTING - webhosting, domény
podmlynom.sk- EXO HOSTING - webhosting, domény
podnahory.skPOD NA HORY
podnikajnanete.skRoman Gajdoš
podnikaniedoma.skPráca z domu
podnikanievturecku.sk- EXO HOSTING - webhosting, domény
podnikatelskeplany.skPodnikateľské plány | Ing. Valéria Kalafutová
podnikatelsky-koucing.sk- EXO HOSTING - webhosting, domény
podnikatelsky-plan.skCLOSER CONSULTING - Podnikateľský plán, finančné sprostredkovanie a úverové poradenstvo
podnikatelsky-zamer.skCLOSER CONSULTING - Podnikateľský plán, finančné sprostredkovanie a úverové poradenstvo
podnikatelskykoucing.sk- EXO HOSTING - webhosting, domény
podnikatelskynapad.skPodnikateľský nápad roka! Predstavte svoj nápad správnym ľuďom a získajte 330 000 na rozbeh podnikania.
podnikatelskynapadroka.skPodnikateľský nápad roka! Predstavte svoj nápad správnym ľuďom a získajte 330 000 na rozbeh podnikania.
podnikavec.skPodnikateľské nápady
podnikovemedium.skPodnikové medium roka
podpisovky.sk- EXO HOSTING - webhosting, domény
podsabavit.sk- EXO HOSTING - webhosting, domény
podsitnom.skPOD SITNOM s.r.o. - Súkromná škola v prírode
podtromakorunami.skPenzión pod Troma Korunami - Ubytovanie Červený Kláštor, Pieniny, Zamagurie
podvojne.sk- EXO HOSTING - webhosting, domény
poe.sk- EXO HOSTING - webhosting, domény
pogannet.sk.:www.POGANNET.sk:. Váš sprostredkovateľ pripojenia...
pogranit.skKamenárstvo Pogranit
pogumovanie.skPogumovanie hnacích bubnov
pohancenik.skMichal Pohancenik
pohlady.sk- EXO HOSTING - webhosting, domény
pohodaprivat.sk..:: Privat POHODA ::..
pohodka.sk- EXO HOSTING - webhosting, domény
pohodlie.skÚvod - pohodlie.sk
pohonzvonov.skTempest - Ladislav Kovács, stavba zvonov
pohostinstvojelsovce.skPohostinstvo Jelšovce - Kvalitná domáca kuchyňa
pohrebna-sluzba-presov.skERA – Kompletné pohrebné služby – PreÅ¡ov, Sabinov NONSTOP 0918 560 422
pohrebnasluzbads.skÚvod - www.domine.sk
pohrebne-sluzby.skERA – Kompletné pohrebné služby – PreÅ¡ov, Sabinov NONSTOP 0918 560 422
pohrebnesluzbyds.skÚvod - www.domine.sk
pohrebnesluzbyhumenne.skPohrebné služby Humenné
pohrebnictvo-kalia.skpohrebnictvo bratislava
pohrebnictvo-presov.skERA – Kompletné pohrebné služby – Prešov, Sabinov NONSTOP 0918 560 422
pohrebnictvobj.skGajdošová Pohrebníctvo Bardejov - Kompletné pohrebné služby, obrady, vence
pohrebnictvopresov.skERA – Kompletné pohrebné služby – Prešov, Sabinov NONSTOP 0918 560 422
pohronskyruskov.skOficiálne stránky obce Pohronský Ruskov
pointers.sk- EXO HOSTING - webhosting, domény
poistenie-analyza.skTo najlepšie poistenie pre Vás
poistenie-auta.skPoistenie auta, istota pre Vaše auto » www.poistfin.sk
poistenie-bytca.skAgentúrna kancelária Allianz - SP - Marián Bohuš - Bytča a Žilina - poistenie
poistenie-financie.sk- EXO HOSTING - webhosting, domény
poistenie-lv.skPoistenie Levice
poistenie-podnikatelov.sk- EXO HOSTING - webhosting, domény
poistenie-poprad.sk- EXO HOSTING - webhosting, domény
poistenie-presov.skRealitná kancelária Allfin Real, s.r.o. - Úvod
poistenie-uvery.skWustenrot Pezinok, OC PLUS Holubyho 28, 902 01 Pezinok, 0915 453060 HAVARIJNÉ POISTENIE, 02 555 713 83
poistenie-zilina.skAgentúrna kancelária Allianz - SP - Marián Bohuš - Bytèa a Žilina - poistenie
poistenie123.skPoistenie online, poistenie auta, povinné zmluvné poistenie, najlacnejšie PZP, životné poistenie
poistenieallianz.sk- EXO HOSTING - webhosting, domény
poistenienacesty.sk- EXO HOSTING - webhosting, domény
poisteniepoprad.skPonuky poistenia | poisteniepoprad.sk
poistenieprevsetkych.skpoistenie pre vsetkych
poistfin.skPoistenie & Financie, s.r.o. Váš sprievodca pre poistenie a financie
pokermoney.skPokermoney - Váš průvodce světem online pokeru
pokladne-rk.skRegistračné pokladnice | KML, s.r.o., Ružomberok
pokladneprelekarov.skPokladne pre lekarov
pokladnerk.skRegistraèné pokladnice | KML, s.r.o., Ružomberok
pokuty24.skAktualisiere deinen Browser | Facebook
polacekoliver.sk- EXO HOSTING - webhosting, domény
polediva.skPole Diva
polepime.skPolepime.sk - kreatívne polepy aut
polepy.skPolep na auto, polep aut, reklamné autopolepy, reklama na auto | POLEPY
polepysk.skPolep na auto, polep aut, reklamné autopolepy, reklama na auto | POLEPY
polepyvykladov.skReklamné polepy výkladov, reklama na okno, samolepiace fólie na okná | POLEPY
polexim.sk- EXO HOSTING - webhosting, domény
polhispa.skJML GLOBAL - consultoria internacional - Polonia - Republica Checa - Eslovaquia
policeregaly.skKovové regály, drevené regály a plastové regály | PoliceRegály.sk
polifarbesk.skPolifarbe SK spol. s r.o. - Spoločnosti
poliklinikamartin.skMartinská poliklinika
polisport.skE-shop - Offroadparts.sk - motocykle online
politickykompas.skPolitický kompas - najväčší slovenský test politickej orientácie
polkaudio.skPolk Audio - Špecialista na reproduktory
polkheritage.skPolk Audio - Heritage séria reproduktorov a slúchadiel od spoločnosti Polk Audio
polno-servis.skPOLNOSERVIS - František Króner
polomcak.skJán Polomčák - World of SCI-FI... Vitajte na mojej stránke!
polopharma.skDistribútor biocídneho prípravku na ošetrenie rán DebriEcaSan a EvellGyn | Polopharma.sk
polotovary.skumakov • polotovary
polovnickenoze.sk- EXO HOSTING - webhosting, domény
polovnickyhotel.skPolovnicky hotel DIANA***
polsky-trh.skJML GLOBAL - consultoria internacional - Polonia - Republica Checa - Eslovaquia
polskytrh.skJML GLOBAL - consultoria internacional - Polonia - Republica Checa - Eslovaquia
polyhaus.sk- EXO HOSTING - webhosting, domény
polyklima.sk- EXO HOSTING - webhosting, domény
polyline.skpolyline architekt
polyoxidonium.skPOLYOXIDONIUM | POLYXTRADE INTERNATIONAL s.r.o. body {scrollbar-face-color: #EAF4FF; scrollbar-highlight-color: #ffffff; scrollbar-shadow-color: #000000; scrollbar-3dlight-color: #777777; scrollbar-arrow-color: #444444; scrollbar-track-color: #
polytechnika.skStredná odborná škola POLYTECHNICKÁ
pomas.skMontáž zariadení obchodov ::POMAS::
pomnikyzkamena.skPomníky z kameňa
pomoc-cloveku.skHome | Just another WordPress site
pomoc-ludom.skPOMOC - ĽUĎOM
pomoc-online.sk- EXO HOSTING - webhosting, domény
pomocnicek.skwww.pomocnicek.sk - Domov
pomoconline.sk- EXO HOSTING - webhosting, domény
pomozem-vam.sk- EXO HOSTING - webhosting, domény
pomozeme-vam.sk- EXO HOSTING - webhosting, domény
pomozemevam.sk- EXO HOSTING - webhosting, domény
pomozemvam.sk- EXO HOSTING - webhosting, domény
pondy.skPONDY.sk - všetko pre Vaše jazierko - PONDY.sk
ponozkynanozky.skPonožky na nôžky - Ponožky na nôžky
ponte.sk- EXO HOSTING - webhosting, domény
pontepardo.skAktualisiere deinen Browser | Facebook
ponuka-prace.skBrigáda, brigády na Slovensku
ponukadomov.sk- EXO HOSTING - webhosting, domény
ponukaprace.skBrigáda, brigády na Slovensku
ponuky-prace.skBrigáda, brigády na Slovensku
popapular.sk- EXO HOSTING - webhosting, domény
popiska.skPopiska - LED popisovacie tabule a reklamné prezentačné systémy
popka.skNetradičné, ručne šité bábiky, originálne darčeky - obchod popka.sk
poplife.skMODX Revolution - Titulní stránka
poprad-gdg.skGDG Poprad-Tatry | Vitajte
popradtatry.skUbytovanie, Reštaurácie, Virtuálne prehliadky, Informácie - Poprad Tatry.sk
populivox.skPeter Bulík (BLOG)
popupular.sk- EXO HOSTING - webhosting, domény
poradenskecentrum.skVitajte na stránke KPS Poradenského centra s.r.o. - KPS - poradenské centrum
poradimevam.skO Nás
porajmos.sk- EXO HOSTING - webhosting, domény
porcelankascak.skKaščák - Dekorácia Porcelánu
poreality.sk- EXO HOSTING - webhosting, domény
porez.skPorez drevotriesky
porgeska.skPorgeska - Caffe Restaurant
pornw.skFree Porn, Free Porn Videos, Amateur Porn, Sex Movie - pornw
porodnaasistencia.skpôrodná asistencia - Zdravotnícka starostlivosť o ženu a dieťa
porodsk.skPríprava na porod
porovnajhypoteku.sk- EXO HOSTING - webhosting, domény
porovnajsi.sk- EXO HOSTING - webhosting, domény
porovnaniecien-autodiely.skAUTODIELY | porovnanie cien pre všetky autodiely za najnižšiu cenu
porquetango.skPorque Tango | Why Tango, Because Tango Ensemble
portal-prace.sk- EXO HOSTING - webhosting, domény
portal4you.skInzertný portál v.2014 - Kompletné internetové inzertné riešenie pre každého
portalprace.sk- EXO HOSTING - webhosting, domény
portotecnica.sk- EXO HOSTING - webhosting, domény
poruban.skwww.poruban.sk - free webhosting, vysoká dostupnosť, registrácia domén, zadarmo webhosting, zadarmo doména, zadarmo domény, neobmedzený webhosting, internetové prezentácie
poruchova-sluzba.skPoruchová služba - Poruchová služba
poruchystavieb.skExpertné a znalecké posúdenia a návrhy riešení porúch | CYKR Expert s.r.o.
posedsi.skPoseď si v bagetérii Baguette
poskimex.sk- EXO HOSTING - webhosting, domény
poslatsms.skSMS zadarmo | PoslatSMS.sk
poslidalej.sk- EXO HOSTING - webhosting, domény
poslovensky.skJazykové korektúry po slovensky - domov
posobeniezelenejkavy.skDoplnok Green Coffee
posolstvo-gralu.skSVET GRÁLU - posolstvo uvod
posolstvogralu.skSVET GRÁLU - posolstvo uvod
pospiech.skČistenie studní
poss-slpc.skPOSS-SLPC home
posteldina.skPosteľ Dina
postelematrace.skPostelematrace | | Všetko pre Váš spánok
postelne-pradlo.skPosteľné prádlo, skvelé ceny | Postelne-pradlo.sk
postelvenezia.skPosteľ Venezia
postielky-klups.sk- EXO HOSTING - webhosting, domény
postsgenius.skNič tu nie je. Zatiaľ.
posudkybn.sk..::Ing Eva Tuchyňová - Znalec v odbore stavebníctvo::..
posudkytuchynova.sk..::Ing Eva Tuchyňová - Znalec v odbore stavebníctvo::..
posudok-znalec.skZnalecké posudky, odborné posudky, odborné vyjadrenia
posudok-znalecky.skVyhotovenie znaleckych posudkov
posunkovarec.skMyslím - centrum kultúry Nepočujúcich
posunkovyjazyk.skMyslím - centrum kultúry Nepočujúcich
pot.skVáš webhosting neexistuje | Websupport.sk
potengapower.skPotenga | Potengapower.sk
potlace.skSieťotlač Ondis s.r.o. potlač tričiek a textilu.
potraviny-pre-mna.skVšetko o zdravých potravinách na jednom mieste
potraviny-premna.sk- EXO HOSTING - webhosting, domény
potraviny.skPOTRAVINY.eu, s.r.o. - elektronický obchod s potravinami
pou.skHra Pou - Informace o hře
pourart.skOZ Pour ART
pouzitefitness.sk- EXO HOSTING - webhosting, domény
povapsys.sk- EXO HOSTING - webhosting, domény
povinna-vybava-auta.skPovinna výbava auta 2015 v SR | Čo má obsahovať?
povrchy.skNeodolateľné povrchy - AffidA
power-horse.skPOWER HORSE | Energy Drink
powerdiesel.skPowerdiesel • Portál
powermagazine.skPower Magazine
poweroil.skPower Oil Group, s.r.o.
powerteam.skPowerTeam - Home
pozemkynapredaj.sk- EXO HOSTING - webhosting, domény
pozemkyprilesiku.skPri Lesíku
pozemkyslnecnejazera.skPozemky Slnečné Jazerá
pozemkytatry.skGolf View Resorts
pozemkyzilina.skStavebné pozemky Krásne Hôrky | Krásne Hôrky
poziarnaprevencia.skPožiarna prevencia
pozic.skInzertný portál pre poskytovanie pôžičiek | Požič.sk
pozicajsinaradie.skPožičovňa náradia Žilina - stavebná mechanizácia
pozicanievozidla.skAutopožičovňa IMPALLA - Krátkodobý a dlhodobý prenájom automobilov
pozicka-no1.skPôžička No1 - Najlepšia pôžička na trhu, porovnanie úrokov
pozickaa.skVeľkonočná pôžička
poziclyze.skPožičovňa lyží a snowboardov - O NÁS
pozicovna-naradia-kosice.skPožičovňa strojov, náradia a prívesných vozíkov | Novátor Košice
pozicovnahodiniek.skWelcome to nginx!
pozicovnakrojov.skPozicovna krojov
pozicovnanitra.skPožičovňa stavebnej mechanizácie v Nitre - KOLEX
pozicovnavysavacov.skLenmar Solution | Hygienické riešenia podľa Vašich predstáv
pozlatenepiny.skHome pozlatenepiny.sk - Výkup pozlatene piny,konektory,baterie ..
poznamka.sk- EXO HOSTING - webhosting, domény
pozorradar.skMobilná aplikácia do auta - Pozor RADAR
pozorrevizor.sk- EXO HOSTING - webhosting, domény
ppapiernictvo.sk- EXO HOSTING - webhosting, domény
ppinvestment.sk- EXO HOSTING - webhosting, domény
ppop.skComing Soon
pppoprad.skPriemyselný park Poprad
ppproduction.skSvadba PP Production - svadba podľa vašich snov.
pprc.skPP Rent Car, s.r.o.
ppsafety.skOsobné ochranné pracovné pomôcky - Ing. Jozef Podolec - PP SAFETY
ppslovakia.skPodlahy, Tapety, Príslušenstvo - PAR-KY, QUICK STEP | P&P Slovakia
ppsone.skChránená dielňa PPS One | Chránené pracovisko
pptaxi.skPP Taxi Zvolen
pr-invest.sk- EXO HOSTING - webhosting, domény
praca-doma.sk- EXO HOSTING - webhosting, domény
praca-kariera.skPraca-kariera.sk | ponuka a inzercia práce | profesia
praca-ponuka.skPráca-Ponuka | Pracovný portál
pracaakozmetika.skPráca s kozmetikou a líčenie
pracabezhranic.skPráca vo Švajčiarsku. Práca pre remeselníkov vo Švajčiarsku. Práca na farmách vo Švajčiarsku. Agentúra PracaBezHranic.sk
pracacezinternet.skNová práca z domu aj cez internet.Skvelá pracovná príležitosť
pracapoprad.skPonuka práce | Vitajte na www.pracapoprad.sk
pracavonku.skPraca v zahraničí
pracavpriemysle.skPráca v priemysle | fullindustry.com
pracawellness.skPraca Wellness
pracky-servis.skServis pračiek a umývačiek riadu - Predaj, dovoz a inštalácia pračiek aj zabudovaných spotrebičov - Miroslav Gavorník
prackyopravy.skMarián Bartoš - Smižany
pracodevy.skPracovné oblečenie
pracovnadoska.skPracovné dosky CORIAN
pracovneodevy-monterky.skPracovné odevy, montérky výroba a predaj Nitra
pracovneodevyaobuv.skPracovné odevy, pracovná obuv - Pracant.eu
pracovnestanice.skPracovné stanice
pracovnykompas.sk- EXO HOSTING - webhosting, domény
praetoria.skPraetoria s.r.o. - Internetový obchod s náradím Dedra - Praetoria internetovy obchod
prakovcata.sk.:: www.prakovcata.sk ::.
pramaclean.skPRAMA CLEAN s.r.o.
praskovefarbenie.skABC DESIGN - praskove farbenie
pravasolnajaskyna.skPravá Soľná Jaskyňa | Vytvorenie a budovanie nových soľných jaskýň na Slovensku aj v zahraničí.
pravdaodiamantoch.sk- EXO HOSTING - webhosting, domény
praveorechove.sklubo michalko
pravneforum.skPrávne Fórum :: Online právna poradňa zdarma
pravnickeskolenia.sk- EXO HOSTING - webhosting, domény
pravnickezrucnosti.sk- EXO HOSTING - webhosting, domény
pravyhodvab.sk- EXO HOSTING - webhosting, domény
pre.sk- EXO HOSTING - webhosting, domény
precoplatit.skPrevencia vzniku pohľadávok | Prečo platiť
precopraveja.sk- EXO HOSTING - webhosting, domény
predaj-cez-internet.skExtraweb - tvorba internetových obchodov a web stránok
predaj-med.skPredaj medu Včielka Helenka
predajcddvd.skPredaj CD a DVD médií - PredajCDDVD.sk
predajci.sk- EXO HOSTING - webhosting, domény
predajdreva.skPREDAJ DREVA
predajizolacie.skPredaj izolácie
predajkotlov.skPredaj a servis kotlov
predajkrbov.skKachle, pece, krby, komíny Spišská Nová Ves
predajmobil.skPredajmobil.sk - Inzeráty zadarmo a bez registrácie na www.predajmobil.sk
predajnamas.skPredajna MaS
predajnanabytku.skPredajnanabytku.sk - Nabytkarstvo.sk
predajnovostavieb.sk- EXO HOSTING - webhosting, domény
predajplotov.skLESA | ploty, poplastované ploty a brány
predajpohladavok.sk- EXO HOSTING - webhosting, domény
predajvin.skEBBL, s.r.o. - Darčekové vína, Mydlá, Ajvary
predam-alternator.skPredaj alternátorov
predam-byt.skPredám 3 izbový byt v Senci
predam-garaz.sk- EXO HOSTING - webhosting, domény
predam-motor.skPredaj motorov
predam-starter.skPredaj štartérov
predamgaraz.sk- EXO HOSTING - webhosting, domény
predas.skPredas.sk - Predas.sk Inzerujte svoju ponuku zadarmo a bez registrácie jednoduchým spôsobom zadávania
predavaj.sk- EXO HOSTING - webhosting, domény
predent.skDoména registrovaná - lioHOSTING.sk
predloha.skÚVOD - Predloha
predops.skPreDops s.r.o. - výroba dosiek plošných spojov
predovka.sk- EXO HOSTING - webhosting, domény
predovky.sk- EXO HOSTING - webhosting, domény
predskolacik.skSúkromná škôlka Bratislava - DC PREDŠKOLÁČIK
predstav.sk:: www.predstavsa.sk
predstavsa.sk:: www.predstavsa.sk
predvolby.skTelefonne Predvolby
prefinancovanieuveru.skPrefinancovanie úveru, refinancovanie hypotéky
prehozy-navliecky.sk   PREHOZY
preklad-anglictina.sk- EXO HOSTING - webhosting, domény
preklad-anglictiny.skPreklad angličtiny, Preklad zo slovenčiny do angličtiny
preklad-nemcina.skJana Valková - Nemčina - Odborný a úradný preklad
preklad-nemciny-slovenciny.skPreklad z nemčiny do slovenčiny, Preklad do nemčiny
preklad-nemciny.skPreklad nemčiny, Preklad zo slovenčiny do nemčiny
preklad-textov.skPreklad textov, Preklad
prekladac-viet.skPrekladač viet - preklad viet a preklad textov
prekladatelska.skRegister prekladateľov SR
prekladstranok.skPreklad web stránok, textov a dokumentov
prekladtextu.skPreklad textu, Preklad
preklady-ticha.skÚradný preklad - www.preklady-ticha.sk
prekladystranok.skPreklad web stránok, textov a dokumentov
prekladywrede.skÚradné preklady nemčina
prekrasu.sk- EXO HOSTING - webhosting, domény
prekyslenie.sk- EXO HOSTING - webhosting, domény
prelepsivranov.skPre Lepsi Vranov
preliezka.skDomov | Preliezky Trubíni
premamu.skOnline obchod - Premamu.sk
premamy.skVšetko pre mamy - Obchod pre v
premesto.skPRE MESTO
premiokosice.skMilujete Vaše auto? My tiež! • A STEEL s.r.o.
premost.skDrevné okná | Drevené dvere | PREMOST.sk
prenajom-leseni.sk- EXO HOSTING - webhosting, domény
prenajom-lodi.skPrenájom lodi
prenajom-rybany.skPrenájom priestorov v obci Rybany - Úvod
prenajom123.skPrenájom projektoru a projekčného plátna Prenajom123.sk
prenajombytu.skPrenájom bytu
prenajomchiavari.sk- EXO HOSTING - webhosting, domény
prenajomdebnenia.skDebnenie na prenájom, Žilina - prenajomdebnenia.sk
prenajomdjtechniky.skOZVUČENIE a OSVETLENIE | SOUND and LIGHT, s.r.o..
prenajomdodavok.skPrenájom dodávok Poprad - Prenájom dodávok Poprad
prenajomkaraoke.skKaraoke Star: …spievanie, mám zo všetkého najradšej…
prenajomkaravanov.skKaravany a Autokaravany na prenájom |Prenájom Karavanov a Autokaravanov
prenajomleseni.skStaves plus - Prenájom montáž lešenia Košice Cena - Lešenie Cenník lešení Prešov, Poprad
prenajomnovezamky.skPrenájom Nové Zámky - Byty na prenájom, predaj bytov a nehnuteľností, Nové Zámky
prenajomosvetlenia.skOZVUČENIE a OSVETLENIE | SOUND and LIGHT, s.r.o..
prenajompodlavice.skBB-REALITY | 2-izbový byt, Banská Bystrica, ulica Lipová, Podlavice
prenajomsidlisko.skBB-REALITY | 2-izbový byt, Banská Bystrica, ulica Petelenova, Centrum
prenajomskutrovkosice.skskútre - prenájom skútrov Košice function clearText(field) { if (field.defaultValue == field.value) field.value = ''; else if (field.value == '') field.value = field.defaultValue; }
prenajomstoliciek.sk- EXO HOSTING - webhosting, domény
prenajomstvorkoliek.skPrenájom štvorkoliek
prenajomtechniky.skExpresný prenájom DJ techniky
prenajomvozidiel-nitra.skPrenájom vozidiel-Nitra.sk AUTOPOŽIČOVŇA
prenoma.skprenoma / Prenoma, s.r.o.
prepelicky.sk- EXO HOSTING - webhosting, domény
prepisvidea.sk- EXO HOSTING - webhosting, domény
prepona.skPREPONA - Predajňa a požičovňa náradia
prepozitura.skPrepozitúra Panny Márie - Úvodná stránka
preprava-varsa.skOnrej Varša - rýchlo - bezpečne - komfortne a bez prestupovania
prepravaopatrovateliek.sk- EXO HOSTING - webhosting, domény
presentas.skReklama, darčeky, polepy, banery, reklamný textil, diáre | Presentas.sk
presov-byty.sk- EXO HOSTING - webhosting, domény
presov-poistenie.skRealitná kancelária Allfin Real, s.r.o. - Úvod
presovskydixieland.skPrešovský dixieland
presovskypivovar.skPrešovský pivovar
presovtv.sk- EXO HOSTING - webhosting, domény
presporskamedovina.skPrešporská medovina | Tradičná prírodná medovina
presporskapivoteka.skSvet rozmanitých chutí piva Prešporská pivotéka
prestieradla-plachty.skPrestieradlá – Plachty
prestige-photo.skPrestige photo
prestigephoto.skPrestige photo
prestimex.skPRESTIMEX s.ro.
prestudenta.skAktualisiere deinen Browser | Facebook
pretekyavysledky.skPreteky a výsledky | Responsive WordPress Gym Fitness Theme
pretty-body.skGuess | Pretty & Body
pretty-trading.skIntro PRETTY Trading
preurady.skPripravujeme // Coming Soon
prezents.skPrezents-reklamná agentúra Pri objednávke nad 45 € doprava zdarma !
prezuj.skVitajte | Prezuj.sk - Pneumatiky, hliníkové disky, plechové disky, kolesá
prezutauto.skPneuservia a predaj pneumatík v Bratislave
prezvolen.skNezávislá iniciatíva pre Zvolen - úvodná stránka
priamypredaj.sk- EXO HOSTING - webhosting, domény
priamypredajyvesrocher.sk- EXO HOSTING - webhosting, domény
prices.sk- EXO HOSTING - webhosting, domény
pridajte.sk- EXO HOSTING - webhosting, domény
pridanahodnota.sk- EXO HOSTING - webhosting, domény
prielozny.skZáhradníctvo Prieložný
priemyselnachemia.skElektro náradie a pracovná technika pre závody, firmy, kutilov aj domácich majstrov - DUVALO.sk
priemyselnazonapoprad.skPriemyselná zóna Poprad-Matejovce
priemyselnyvysavac.skpriemyselný vysávač
priesaky.skPriesaky a zatekanie do budov
prieskumnamieru.skPrieskum Na Mieru –
prihlasenievozidla.skwww.prihlasenievozidla.sk » Vaše auto naše starosti
primareality.skPRIMA realitná a právna kancelária
primataxi.skPrimaTaxi - Vaša taxislužba | Kontakt
primaubytovanie.sk- EXO HOSTING - webhosting, domény
principium.skPrincipium - školenia, semináre, pracovné príležitosti
print123.skVeľkoformátová/veľkoplošná tlač - BIG PRINT
printcloud.sk- EXO HOSTING - webhosting, domény
printe.skTonery a náplne do tlačiarní
printerio.skPrinterio - veľkoobchod náplne do tlačiarní, tonery, cartridge
printon.skPrinton s.r.o. - Titulná stránka
printonline.sk- EXO HOSTING - webhosting, domény
printworld.sk- EXO HOSTING - webhosting, domény
pripravujeme.sk- EXO HOSTING - webhosting, domény
prirodalieci.skHLAVNÁ STRÁNKA
prirodanasbavi.skPríroda nás baví - Úvodná strana
prirodnaliecba.skPrírodná liečba - UNREGISTERED VERSION
prirodneobklady.skPrirodne Obklady
prisonpizza.skPrison Pizza
pristrojela.skThe Tudors
privat-gerlachov.skPrivát Gerlachov
privat-hacava.skPrivát Hačava - ubytovanie v srdci prírody
privat384.sk..:: Privát 384 - penzión, ubytovanie, Spišský Štiavnik ::..
privatanna.sk-= Privat Anna - ubytovanie -Terchová, Malá Fatra, Vrátna =-
privatdebt.skPRIVATdebt - expert na vymáhanie pohľadávok
privatflanderova.skPrivát - Valéria Flanderová
privatkamilka.skPrivat Kamilka
privatkatrina.skPrivatKatrina.sk - Privat Katrina Liptovský Trnovec - ubytovanie na Liptove
privatliptov.sk- EXO HOSTING - webhosting, domény
privatlubica.skPrivát Ľubica - ubytovanie, Liptov, Vysoké Tatry
privatprima.skAk na pobyt, tak jedine k nám :)
privatseverka.sk- EXO HOSTING - webhosting, domény
privatsherpa.skPrivat Sherpa | Ubytovanie v Tatrach za rozumnu cenu.
privatsiesta.skPrivát Siesta - presmerovanie na FB
privatsvist.skVila Svišť
privatumervarta.skUbytovanie Privát U Mervarta - Mengusovce Vysoké Tatry - cenovo prístupné ubytovanie
prizma.skKonferencia PRIZMA
pro-fundus.sk- EXO HOSTING - webhosting, domény
pro-mobil.skpro mobil
proamericana.skPro Americana - Jazyková škola. Anglický jazyk pre materské
probar.skBarové potreby - ProBarShop.sk
proben.skProBen - ortopedicko-protetické pomôcky
probet.skproBET.sk | Tipovanie, tipy, analýzy, správy, výsledky, štatistiky, diskusia
probunka.sk- EXO HOSTING - webhosting, domény
processcontrol.skProcess Control s.r.o.
procka.skLife is what you make out of it
procom.skProCom, spol. s r.o.
procontrol.skPROCONTROL – SK, s.r.o.
procurement.skITAPS s. r. o.
prodeck.sk- EXO HOSTING - webhosting, domény
proding.skProding s.r.o. Banska Bystrica
prodlazba.skProdlažba - Vymývaná dlažba z dunajského štrku
productdesign.skNerezové lavičky
productfeed.sk Podporujeme zdravie u zvierat! |
production.sk- EXO HOSTING - webhosting, domény
produktova-fotografia.skVáš webhosting neexistuje | Websupport.sk
produktovyweb.sk- EXO HOSTING - webhosting, domény
proecon.sk- EXO HOSTING - webhosting, domény
proeducation.skProEducation | SMART PEOPLE MATTER …
proelite.skWelcome to ProElite - The Chemical Company | ProElite - The Chemical Company
proenergo.sk- EXO HOSTING - webhosting, domény
profesionalita.skTitle Here
profesionalna-kozmetika.sk- EXO HOSTING - webhosting, domény
profesionalnakozmetika.sk- EXO HOSTING - webhosting, domény
profesionalny-koucing.sk- EXO HOSTING - webhosting, domény
profesionalnykoucing.sk- EXO HOSTING - webhosting, domény
profi-autoservis.skPROFI-AUTOSERVIS, s.r.o. Lokca, kvalitný a dostupný servis pre Vaše auto
profi-chiptuning.skNovinky | MM RACING - chiptuning
profi-farby.skProfi FARBY | pre to pravé použitie
profi-hair.skProfi Hair
profi-naplne.sk- EXO HOSTING - webhosting, domény
profi-obkladac.skObkladanie | profi-obkladac.sk
profi-toner.sk- EXO HOSTING - webhosting, domény
profi-tuning.skChip tuning, auto diagnostika | mmracing.sk Bratislava
profiautokozmetika.skStar Brite - Profesionálna autokozmetika
proficon.skProFiCon, s.r.o. - Profil
profidach.sk- EXO HOSTING - webhosting, domény
profidesign.skReklamná agentúra PROFI design, s.r.o., Dolný Kubín - komplexné reklamné služby
profidetektory.sk- EXO HOSTING - webhosting, domény
profighters.skProFighters všetko pre bojové športy
profiheat.skhttp://www.profiheat.sk/ Úvod
profika.skPROFIKA.SK | Predaj a servis CNC strojov, konštrukcia a výroba nástrojov
profiland.sk- EXO HOSTING - webhosting, domény
profiledky.sk- EXO HOSTING - webhosting, domény
profilinvest.skProfil Invest Slovakia s.r.o. - Plastové, hliníkové okná a dvere
profilter.skProfilter - priemyselná filtrácia vody
profima.skP R O F I M A - Náradie profesionálov
profimasaze.skProfi Masáže - Štúdio Krásy - Darina Malá, tel. 0905-943-563, Trnava
profimaska.skNHT Global - Tvoríme tradíciu wellness
profimotor.skOprava motorov a ich súčastí | Profimotor
profin.skProfin.sk - Pois
profinac.sk- EXO HOSTING - webhosting, domény
profinex.skProfinex - Kuchynské štúdio, kuchynské linky na mieru, interiérový dizajn, podlahy, nábytok
profioblecenie.sk- EXO HOSTING - webhosting, domény
profipanel.skProfiPanel s.r.o
profipojex.sk- EXO HOSTING - webhosting, domény
profistore.skProfiStore - elektronika, elektrotechnika
profit-nabytok.skProfit Nábytok - Čalúnený nábytok - Výroba a predaj čalúneného nábytku
profitest.skPROFITEST || Inžinierska činnosť pre vyhradené technické zariadenia
profitparketbytca.skTvorba web stránok | EDMAX, s.r.o.
profituj.sk- EXO HOSTING - webhosting, domény
profiuctovnicka.skCAS s.r.o.
profizahradkar.skProfi ZÁHRADKÁR
profylaktika.skČistenie a servis počítačov • Profylaktika
profylaxia.sk- EXO HOSTING - webhosting, domény
program.skTV program na Program.sk
programtv.skTV program na Program.sk
progresmt.skPROGRES MT | ... nerobíme JEDNU VEC O 100% lepšie ako iní, ale robíme 100 VECÍ O 1 % lepšie ako iní ...
progrespersonal.skProgres Personal Leasing
progresstechnologies.skSpráva budov, bytov a nebytových priestorov. Upratovacie služby
progrestherm.skPROGRES THERM s.r.o. | Všetko ohľadom vody, kúrenia, plynu a kanalizácie
prohodinky.sk- EXO HOSTING - webhosting, domény
prointerpreter.skPro Interpreter - simultánne, konferenčné a konzekutívne tlmočenie, tlmočník a prekladateľ, preklady jazykov angličtina, francúzština, Bratislava, Trnava
project-lehnice.skPOJECT-LEHNICE - Home
projectinterier.skProject Interier | DOMOV
projectpb.skUntitled Document
projectum.sk- EXO HOSTING - webhosting, domény
projectx.skProject X - MOTEL KAMENEC - 15.8.2014
projekciasvrcek.skÚvod | P.S - projekt
projekt-domu.skProjekty domov - Rodinné domy VITADOM
projekthemon.sk- EXO HOSTING - webhosting, domény
projektshop.skProjektshop is coming soon
projektxcape.sk- EXO HOSTING - webhosting, domény
projektybudov.skProjekcia statiky stavieb
projektypredeti.skProjekty pre deti - Úvod
projektystavieb.skINPRO spol. s r.o. Prievidza - projekty stavieb, projektovanie
projektyzateplenia.skProjekty zateplenia - Vaše bývanie krajšie a úspornejšie
prokancel.sk- EXO HOSTING - webhosting, domény
proksova.skGabriela Proksova
prokyon.skPROKYON - Výroba reklamy - O firme
prolad.skProLad s.r.o. | projekčná a architektonická kancelária Martin, Žilina, Dolný Kubín
prolegis.sk- EXO HOSTING - webhosting, domény
prolink.skPROLINK - P R I N T H I N G S
promark.sk- EXO HOSTING - webhosting, domény
promatic.sk- EXO HOSTING - webhosting, domény
promifashion.skDomov - Promi Fashion.sk
promodel.skProModel - modelovanie, architektonické modely, modely, miniatúry, scale, mierka, plasty, CNC fréza, metal etching, leptanie
promodesign.skPROMO DESIGN s.r.o.
promonotes.skwww.promonotes.sk | KATALÓG REKLAMNÝCH PREDMETOV | VÝROBA
promont.skPromont spol. s r.o. Prešov - voda - plyn - kúrenie - projekcia - montáž - servis - technológie vykurovania
promontasro.sk- EXO HOSTING - webhosting, domény
promontca.skPromont - zasklievanie balkónov a terás, výroba vitráží a dekoračného skla - O nás
promotionmedia-autofolie.skAUTOFÓLIE - PROMOTION MEDIA, s.r.o. - Považská Bystrica, Púchov, Bytča, Žilina, Ilava, Trenčín, Dubnica nad Váhom - autofólie HP PROSOLAR, dodávka a montáž autofólií
promotionmedia.skAUTOFÓLIE - PROMOTION MEDIA, s.r.o. - Považská Bystrica, Púchov, Bytča, Žilina, Ilava, Trenčín, Dubnica nad Váhom - autofólie HP PROSOLAR, dodávka a montáž autofólií
promoto.skPromoto - promoto.sk - moto príslušenstvo
promovideo.skVideo pre Vás | Zviditeľnite sa prostredníctvom videa …
proorder.skProOrder - system for making orders and bookings
proper.sk- EXO HOSTING - webhosting, domény
properservis.skProper Servis - cleaning & garden services
prophotostudio.skProphotostudio s.r.o.
propopulo.skPro POPULO
proposal.sk- EXO HOSTING - webhosting, domény
proproduction.skPRO//PRODUCTION sound & light | ozvučenie, osvetlenie, videoprojekcie, led steny
prorax.skprorax Splash
proreality.skProReality - realitná kancelária
prosecco-vino.skHistória - Prosecco-vino.sk
prosit.sk- EXO HOSTING - webhosting, domény
prospark.sk- www.exohosting.sk - Vás profi webhosting
prosportshop.ske-shop, tvorba a pronájem e-shopu, e-shop software, internetový obchod, B2B, B2C, SEO | OXID eShop
prostredna.sk- EXO HOSTING - webhosting, domény
prostroj.skÚVOD - Prostroj s.r.o.| Výroba náhradných dielov a pneumatických sejacích strojov
protectionband.skAktualisiere deinen Browser | Facebook
protego.skSEO Optimalizácia - Protego
protein-bielkoviny.skPROTEIN | ESHOP – Proteiny pre športovcov –
protein-kreatin.skProtein Kreatin | Protein a kreatín – najdôležitejšie suplementy pre športovcov
proteingainer.skwww.svetsvalov.sk | Internetový obchod s doplnkami výživy za najnižšie ceny v SR
protelcont.skProtelcont s. r. o. - Meranie a regulácia, riadenie technologických procesov, diaľkový prenos dát, dispečingy
protikomarom.sk- EXO HOSTING - webhosting, domény
protismer.sk- EXO HOSTING - webhosting, domény
protourion.skInkaso a vymáhanie pohľadávok
provance.skNábytok Provance
provans.skProvans Design | zmeňte svoje bývanie na vysnívaný domov
provencevm.skProvence apartmany
proviant.sk- EXO HOSTING - webhosting, domény
provitalis.skProVitalis - Súkromné centrum prevencie a regenerácie
prowellness.skProWellness.sk - Wellness centrá, maséri a relax
prowil.skPROWIL.sk - obklady, dlažby
proximus.sk- EXO HOSTING - webhosting, domény
proxone.sk- EXO HOSTING - webhosting, domény
prr.skPRR Reality - Najnovšie ponuky
prsiasudar.skPrsia sú dar - Mamografické a ultrazvukové vyšetrenia
prst.skpomoc,ochrana, zabezpečenie, minikamery, odposluch - PRST SK - Ochrana, zabezpečenie a minikamery
prsteneonline.sk- EXO HOSTING - webhosting, domény
prtrade.skZákladná stránka webhostingu | Websupport.sk
prvanzstk.skPrvá Novozámocká STK | Technické kontroly, Emisné kontroly, Kontroly originality
prvapomockurz.skLSE – Life Star Emergency – kurzy inštruktorov a záchranárov | Kurz prvej pomoci
prvaslnecna.sk- EXO HOSTING - webhosting, domény
prvelastovicky.skObčianske združenie Prvé lastovičky - Hlavná stránka
prvypravnydom.skPrvý právny dom - Kuzmányho 4, Martin
pryzmat.skMapa sklepów - Pryzmat
ps5.sk- EXO HOSTING - webhosting, domény
psc-impulz.skPracovno-socializačné centrum Impulz | Chceme žiť s Vami, nie vedľa Vás.
psera.skERA – Kompletné pohrebné služby – PreÅ¡ov, Sabinov NONSTOP 0918 560 422
psiakozmetika.skPsia Kozmetika
psiecentrum.skDog House - najlepší hotel pre Vašich štvornohých miláčikov
psiedobroty.skPsie Dobroty
psiemnamky.sk- EXO HOSTING - webhosting, domény
psieoblecenie.skNika Dog Fashion - Oblečenie pre psíkov
psipark.skPsí Park | Voľný pohyb, výcvik, šport, zábava
psiraj.skhotel pre psy | Vitajte v hoteli pre psov Psí raj, psia škôlka Bratislava, psia škôlka v Bratislave, hotel pre psov v Bratislave
psiuces.skPsí účes
psiutulok.skÚtulok Lučenec | Regionálne Centrum Slobody Zvierat (Lučenec)
psmail.skNatamedia | Tvorba webových stránok | Online marketing
psnr.skPozemkové spoločenstvo Nižné Ružbachy - O NÁS
psprofile.sk- EXO HOSTING - webhosting, domény
psr.sk- EXO HOSTING - webhosting, domény
psreality.skMagazín o realitách a stavebníctve pre Bratislavu a okolie | PS reality
pssolution.skPS Solution – tie správne riešenia – O nás
pstros.sk- EXO HOSTING - webhosting, domény